AAstretch launched 26/10/2010 at 10:55:48
alpha	0.05
data_source	arabidopsis_thaliana.prot.txt
explore	0
flank_length	30
flank_start	0
ignore	(predicted|hypothetical|potential|ann\|---)
isoform_check	on
patt_extrem_len	2
patt_gap_max_number	100
patt_gap_min_size	0
patt_stretch_max_size	1000
patt_stretch_min_size	5
residue	Q
rich_gap_tolerance	auto
rich_stretch_min_aa_perc	20
rich_stretch_min_size	30
rich_verbose	0
rich_win_length	5
scan	1
scanmode	seed
seed_gap_max_size	5
seed_seed_max_size	1000
seed_seed_min_size	5
seed_stretch_min_aa_perc	75
sync	1
tuple	1
verbose	0
Global_stat_tup_1	810910	611014	686191	854305	683360	807061	845791	672437	1202555	311636	800436	158379	359501	539933	1150216	645645	287880	233086	555270	442266	
Available sequences	31344
Total AA count	12657874
Total stretches found	340
1st-M	31307
Name	Len	Stretches_tot	Stretch_seq	Stretch_len	Q%	pureQ_len	pureQ_ratio	start	stop	Position%	lf_seq	rf_seq	go_func	go_proc	go_comp	omim
>prot|EG:AT3G44650.1-P|cod|AT3G44650.1-TAIR|gene|AT3G44650-TAIR-G|ann|transposable element gene; non-LTR retrotransposon family (LINE), has a 5.1e-43 P-value blast match to GB:NP_038605 L1 repeat, Tf subfamily, member 30 (LINE-element) (Mus musculus)	771	1	QQQQQ	5	100	5	1	582	586	75	AWTSRRRRHHRQEILNTIEEVLSTQHQKRT	GRVLWKGKNDIYKDKFSTKNTWNYLRTTSN	GO:0005575:cellular_component;	GO:0006278:RNA-dependent DNA replication;GO:0008150:biological_process;	GO:0003674:molecular_function;GO:0003723:RNA binding;GO:0003964:RNA-directed DNA polymerase activity;	---
>prot|EG:AT2G45530.1-P|cod|AT2G45530.1-TAIR|gene|AT2G45530-TAIR-G|ann|zinc finger (C3HC4-type RING finger) family protein; zinc finger (C3HC4-type RING finger) family protein; FUNCTIONS IN: zinc ion binding; EXPRESSED IN: 22 plant structures; EXPRESSED DURING: 13 growth stages; CONTAINS InterPro DOMAIN/s: Zinc finger, RING/FYVE/PHD-type (InterPro:IPR013083), Zinc finger, RING-CH-type (InterPro:IPR011016); BEST Arabidopsis thaliana protein match is: zinc finger (C3HC4-type RING finger) family protein (TAIR:AT2G37950.1); Has 621 Blast hits to 621 proteins in 69 species: Archae - 0; Bacteria - 0; Metazoa - 262; Fungi - 5; Plants - 312; Viruses - 3; Other Eukaryotes - 39 (source: NCBI BLink).	240	1	QQQQQQ	6	100	6	1	15	20	6	MQSSSSSGGDDLEKQQQQQQKDKSPQKQSE	KDKSPQKQSESANESNHLTIVVCNGDSSRE	---	---	GO:0005515:protein binding;GO:0008270:zinc ion binding;	---
>prot|EG:AT4G18260.1-P|cod|AT4G18260.1-TAIR|gene|AT4G18260-TAIR-G|ann|cytochrome B561-related; cytochrome B561-related; LOCATED IN: membrane; EXPRESSED IN: 20 plant structures; EXPRESSED DURING: 10 growth stages; CONTAINS InterPro DOMAIN/s: Cytochrome b561/ferric reductase transmembrane (InterPro:IPR006593); BEST Arabidopsis thaliana protein match is: membrane protein, putative (TAIR:AT2G30890.1); Has 661 Blast hits to 590 proteins in 118 species: Archae - 0; Bacteria - 5; Metazoa - 109; Fungi - 70; Plants - 217; Viruses - 2; Other Eukaryotes - 258 (source: NCBI BLink).	545	1	QQQQQ	5	100	5	1	535	539	98	LKQRRQEQATNRREKLKQAYLRKQLEKLKA	EDEQKT	GO:0016020:membrane;	---	---	---
>prot|EG:AT5G58380.1-P|cod|AT5G58380.1-TAIR|gene|AT5G58380-TAIR-G|ann|SIP1 (SOS3-INTERACTING PROTEIN 1); ATP binding / kinase/ protein kinase/ protein serine/threonine kinase; Encodes a CBL-interacting protein kinase with similarity to SOS protein kinase.	479	1	QQQQQQEQQEQ	11	81.8181818181818	6	0.545454545454545	463	473	96	AEDLRPALSDIVWVWQGEKDELTSQQETEY	EEPLKF	GO:0005575:cellular_component;	GO:0006468:protein amino acid phosphorylation;GO:0007165:signal transduction;	GO:0000166:nucleotide binding;GO:0004672:protein kinase activity;GO:0004674:protein serine/threonine kinase activity;GO:0004713:protein tyrosine kinase activity;GO:0005515:protein binding;GO:0005524:ATP binding;GO:0016301:kinase activity;GO:0016740:transferase activity;GO:0030145:manganese ion binding;	---
>prot|EG:AT1G52320.2-P|cod|AT1G52320.2-TAIR|gene|AT1G52320-TAIR-G|ann|unknown protein; unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: N-terminal protein myristoylation; LOCATED IN: plasma membrane; EXPRESSED IN: 23 plant structures; EXPRESSED DURING: 14 growth stages; CONTAINS InterPro DOMAIN/s: Protein of unknown function DUF630 (InterPro:IPR006868), Protein of unknown function DUF632 (InterPro:IPR006867); BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT5G25590.1); Has 8111 Blast hits to 6764 proteins in 511 species: Archae - 9; Bacteria - 475; Metazoa - 3444; Fungi - 1217; Plants - 1004; Viruses - 207; Other Eukaryotes - 1755 (source: NCBI BLink).	798	1	QHQHQHQQQQQQ	12	75	6	0.5	223	234	27	RTTIEDHHLQEEKAPPPPPLANSRPIPPPR	PFYDYFFPNVENMPGTTLEDTPPQPQPQPT	GO:0005886:plasma membrane;	GO:0042309:homoiothermy;GO:0050826:response to freezing;	GO:0003674:molecular_function;GO:0050825:ice binding;	---
>prot|EG:AT1G54080.2-P|cod|AT1G54080.2-TAIR|gene|AT1G54080-TAIR-G|ann|oligouridylate-binding protein, putative; OLIGOURIDYLATE-BINDING PROTEIN 1A (UBP1A); FUNCTIONS IN: mRNA 3'-UTR binding; LOCATED IN: plasma membrane; EXPRESSED IN: 24 plant structures; EXPRESSED DURING: 14 growth stages; CONTAINS InterPro DOMAIN/s: RNA recognition motif, RNP-1 (InterPro:IPR000504), Nucleotide-binding, alpha-beta plait (InterPro:IPR012677); BEST Arabidopsis thaliana protein match is: oligouridylate-binding protein, putative (TAIR:AT3G14100.1); Has 17031 Blast hits to 11784 proteins in 528 species: Archae - 0; Bacteria - 657; Metazoa - 10092; Fungi - 1999; Plants - 2583; Viruses - 0; Other Eukaryotes - 1700 (source: NCBI BLink).	430	1	QQQQQQQQQHQQ	12	91.6666666666667	9	0.75	9	20	2	MQNQRLIKQQQQQQQQQHQQAMIQQAMMQQ	AMIQQAMMQQHPSLYHPGVMAPPQMEPLPS	GO:0005886:plasma membrane;	---	GO:0000166:nucleotide binding;GO:0003676:nucleic acid binding;GO:0003730:mRNA 3'-UTR binding;	---
>prot|EG:AT2G13570.1-P|cod|AT2G13570.1-TAIR|gene|AT2G13570-TAIR-G|ann|NF-YB7 (NUCLEAR FACTOR Y, SUBUNIT B7); transcription factor; NUCLEAR FACTOR Y, SUBUNIT B7 (NF-YB7); FUNCTIONS IN: transcription factor activity; INVOLVED IN: regulation of transcription, DNA-dependent; LOCATED IN: nucleus, intracellular; EXPRESSED IN: 8 plant structures; EXPRESSED DURING: L mature pollen stage, M germinated pollen stage, 4 anthesis, petal differentiation and expansion stage; CONTAINS InterPro DOMAIN/s: Transcription factor, CBFA/NFYB, DNA topoisomerase (InterPro:IPR003957), Transcription factor CBF/NF-Y/archaeal histone (InterPro:IPR003958), Histone-fold (InterPro:IPR009072), Transcription factor, NFYB/HAP3, conserved site (InterPro:IPR003956); BEST Arabidopsis thaliana protein match is: NF-YB3 (NUCLEAR FACTOR Y, SUBUNIT B3); transcription factor (TAIR:AT4G14540.1); Has 1381 Blast hits to 1361 proteins in 183 species: Archae - 0; Bacteria - 0; Metazoa - 479; Fungi - 268; Plants - 295; Viruses - 0; Other Eukaryotes - 339 (source: NCBI BLink).	215	1	QQQQRQQQQQIQQQ	14	85.7142857142857	5	0.357142857142857	136	149	63	TLGFEDYVAPLKVYLCKYRDTEGEKVNSPK	NHHNYQFQEQDQNNNNMSCTSYISHHHPSP	GO:0005622:intracellular;GO:0005634:nucleus;	GO:0006350:transcription;GO:0006355:regulation of transcription, DNA-dependent;GO:0045449:regulation of transcription;	GO:0003677:DNA binding;GO:0003700:sequence-specific DNA binding transcription factor activity;GO:0043565:sequence-specific DNA binding;	---
>prot|EG:AT1G30050.1-P|cod|AT1G30050.1-TAIR|gene|AT1G30050-TAIR-G|ann|unknown protein; unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT5G01970.1); Has 168 Blast hits to 166 proteins in 45 species: Archae - 0; Bacteria - 4; Metazoa - 70; Fungi - 4; Plants - 58; Viruses - 0; Other Eukaryotes - 32 (source: NCBI BLink).	389	1	QQQQQQQQ	8	100	8	1	96	103	24	FTAYEDKSESRGFWGILAQKAKSILEDEEE	NDVIFEPSNPTIRKSIDKITTSLNHIGDSF	---	GO:0008150:biological_process;	GO:0003674:molecular_function;	---
>prot|EG:AT1G07705.1-P|cod|AT1G07705.1-TAIR|gene|AT1G07705-TAIR-G|ann|transcription regulator; transcription regulator; FUNCTIONS IN: transcription regulator activity; INVOLVED IN: regulation of transcription; LOCATED IN: nucleus, chloroplast; EXPRESSED IN: 23 plant structures; EXPRESSED DURING: 13 growth stages; CONTAINS InterPro DOMAIN/s: NOT2/NOT3/NOT5 (InterPro:IPR007282); BEST Arabidopsis thaliana protein match is: VIP2 (VIRE2 INTERACTING PROTEIN2); protein binding / transcription regulator (TAIR:AT5G59710.1); Has 2774 Blast hits to 2106 proteins in 307 species: Archae - 0; Bacteria - 642; Metazoa - 845; Fungi - 346; Plants - 142; Viruses - 8; Other Eukaryotes - 791 (source: NCBI BLink).	546	1	QQQQQHAQ	8	75	5	0.625	340	347	62	NSVLMMQSQQLSMGRSGGFNLGGAYTSHRP	AVSSSGVSLHGSDIFSSSHPPYHSQTGGAP	GO:0005634:nucleus;GO:0005783:endoplasmic reticulum;GO:0009507:chloroplast;	GO:0045449:regulation of transcription;	GO:0030528:transcription regulator activity;	---
>prot|EG:AT1G72980.1-P|cod|AT1G72980.1-TAIR|gene|AT1G72980-TAIR-G|ann|LBD7 (LOB DOMAIN-CONTAINING PROTEIN 7); LBD7 (LOB DOMAIN-CONTAINING PROTEIN 7); CONTAINS InterPro DOMAIN/s: Lateral organ boundaries, LOB (InterPro:IPR004883); BEST Arabidopsis thaliana protein match is: LBD22 (LOB DOMAIN-CONTAINING PROTEIN 22) (TAIR:AT3G13850.1); Has 524 Blast hits to 522 proteins in 26 species: Archae - 0; Bacteria - 2; Metazoa - 5; Fungi - 0; Plants - 493; Viruses - 0; Other Eukaryotes - 24 (source: NCBI BLink).	214	1	QQQQQ	5	100	5	1	166	170	77	SFESLLQQDGDEYVNVDGLDHQNMQQQQEM	NPSNYDMFLEMPEQTSKVKLEEEKISDQRK	GO:0005634:nucleus;	GO:0006355:regulation of transcription, DNA-dependent;	GO:0003700:sequence-specific DNA binding transcription factor activity;GO:0008270:zinc ion binding;	---
>prot|EG:AT5G43150.1-P|cod|AT5G43150.1-TAIR|gene|AT5G43150-TAIR-G|ann|unknown protein; unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: mitochondrion; EXPRESSED IN: 22 plant structures; EXPRESSED DURING: 13 growth stages; Has 50 Blast hits to 50 proteins in 8 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 50; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink).	91	1	QQQQQQ	6	100	6	1	69	74	75	EHDVSSCEYEDIHIMWNLLHKNEDLTRVPI	RKKPCWNLLGSYLCQRF	GO:0005739:mitochondrion;	GO:0008150:biological_process;	GO:0003674:molecular_function;	---
>prot|EG:AT2G32710.1-P|cod|AT2G32710.1-TAIR|gene|AT2G32710-TAIR-G|ann|KRP4; cyclin binding / cyclin-dependent protein kinase inhibitor; Kip-related protein (KRP) gene, encodes CDK (cyclin-dependent kinase) inhibitor (CKI). A member of seven KRP genes found in Arabidopsis thaliana. Negative regulator of cell division. Expressed in actively dividing cells.	289	1	QQQQQ	5	100	5	1	57	61	19	GESSIALMDVVSPSSSSSLGVLTRAKSLAL	RCLLQKPSSPSSLPPTSASPNPPSKQKMKK	GO:0005634:nucleus;GO:0005654:nucleoplasm;	GO:0007049:cell cycle;GO:0007050:cell cycle arrest;GO:0045736:negative regulation of cyclin-dependent protein kinase activity;GO:0045786:negative regulation of cell cycle;	GO:0004860:protein kinase inhibitor activity;GO:0004861:cyclin-dependent protein kinase inhibitor activity;GO:0030332:cyclin binding;	---
>prot|EG:AT4G20300.2-P|cod|AT4G20300.2-TAIR|gene|AT4G20300-TAIR-G|ann|unknown protein; unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; EXPRESSED IN: 24 plant structures; EXPRESSED DURING: 15 growth stages; CONTAINS InterPro DOMAIN/s: Protein of unknown function DUF1639 (InterPro:IPR012438); BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT1G55340.2); Has 456 Blast hits to 442 proteins in 73 species: Archae - 0; Bacteria - 7; Metazoa - 184; Fungi - 40; Plants - 150; Viruses - 0; Other Eukaryotes - 75 (source: NCBI BLink).	352	1	QQQQQQQ	7	100	7	1	79	85	22	RGFNGGSCTTTTNNTSSLDGVPKGFRFRST	DPSPSRRGGDVLLQWGQRKRSRASRAEIRS	---	GO:0008150:biological_process;	GO:0003674:molecular_function;	---
>prot|EG:AT1G29350.1-P|cod|AT1G29350.1-TAIR|gene|AT1G29350-TAIR-G|ann|unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: cellular_component unknown; EXPRESSED IN: male gametophyte, guard cell, pollen tube; EXPRESSED DURING: L mature pollen stage, M germinated pollen stage; CONTAINS InterPro DOMAIN/s: Protein of unknown function DUF1296 (InterPro:IPR009719); BEST Arabidopsis thaliana protein match is: kinase-related (TAIR:AT1G29370.1); Has 13611 Blast hits to 7582 proteins in 387 species: Archae - 0; Bacteria - 354; Metazoa - 5683; Fungi - 1538; Plants - 892; Viruses - 68; Other Eukaryotes - 5076 (source: NCBI BLink).	831	1	QQQQQQQQHQQQ	12	91.6666666666667	8	0.666666666666667	712	723	85	LNQQSATTGTTLGYEDVLSSQYKENHLLAL	NENSAMWHQGHGSRTMSGVPTNTYYNLQAQ	GO:0005575:cellular_component;	GO:0008150:biological_process;	GO:0003674:molecular_function;	---
>prot|EG:AT5G20930.1-P|cod|AT5G20930.1-TAIR|gene|AT5G20930-TAIR-G|ann|TSL (TOUSLED); kinase/ protein serine/threonine kinase; Nuclear serine/threonine protein kinase that requires a coiled-coil region for oligomerization and catalytic activity. Required for leaf and flower development. Expression localized to the developing style by stage 13.	688	1	QQQQQQQQQ	9	100	9	1	44	52	6	SNQSDHSLPDKIAKLEARLTGKTPSSAKPP	VSLWSSASAAVKVVTSTPPGLSETSISDSD	GO:0005634:nucleus;GO:0005737:cytoplasm;GO:0009507:chloroplast;	GO:0006468:protein amino acid phosphorylation;	GO:0000166:nucleotide binding;GO:0004672:protein kinase activity;GO:0004674:protein serine/threonine kinase activity;GO:0004713:protein tyrosine kinase activity;GO:0005524:ATP binding;GO:0016301:kinase activity;GO:0016740:transferase activity;	---
>prot|EG:AT3G50370.1-P|cod|AT3G50370.1-TAIR|gene|AT3G50370-TAIR-G|ann|unknown protein; unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: cellular_component unknown; EXPRESSED IN: 26 plant structures; EXPRESSED DURING: 15 growth stages; Has 43668 Blast hits to 22560 proteins in 1277 species: Archae - 119; Bacteria - 4801; Metazoa - 19184; Fungi - 3840; Plants - 1250; Viruses - 317; Other Eukaryotes - 14157 (source: NCBI BLink).	2156	1	QQQQQQSSQ	9	77.7777777777778	6	0.666666666666667	2074	2082	96	GAPPAKPTSTLSDPNSNNTQNPNGPGFKPP	EKNTQSQHVGGPSHHHQHQHHQNRRSGYHG	GO:0005575:cellular_component;	GO:0008150:biological_process;	GO:0003674:molecular_function;	---
>prot|EG:AT1G43850.2-P|cod|AT1G43850.2-TAIR|gene|AT1G43850-TAIR-G|ann|SEU (seuss); DNA binding / protein binding / protein heterodimerization/ transcription cofactor; Encodes a transcriptional co-regulator of AGAMOUS, that functions with LEUNIG to repress AG in the outer floral whorls.	877	3	QVQQQQQ	7	85.7142857142857	5	0.714285714285714	184	190	20	QFSTVRGGGLAGVGPVKMEPGQVSNDQQHG	KMLRNLGSVKLEPQQIQAMRNLAQVKMEPQ	GO:0005634:nucleus;	GO:0006350:transcription;GO:0007275:multicellular organismal development;GO:0009908:flower development;GO:0009909:regulation of flower development;GO:0030154:cell differentiation;GO:0045449:regulation of transcription;	GO:0003677:DNA binding;GO:0003712:transcription cofactor activity;GO:0005515:protein binding;GO:0046982:protein heterodimerization activity;	---
>prot|EG:AT1G43850.2-P|cod|AT1G43850.2-TAIR|gene|AT1G43850-TAIR-G|ann|SEU (seuss); DNA binding / protein binding / protein heterodimerization/ transcription cofactor; Encodes a transcriptional co-regulator of AGAMOUS, that functions with LEUNIG to repress AG in the outer floral whorls.	877	3	QQQQRQQQQQQQQQFLQ	17	82.3529411764706	9	0.529411764705882	229	245	26	VKLEPQQIQAMRNLAQVKMEPQHSEQSLFL	MPGQSPQAQMNIFQQQRLMQLQQQQLLKSM	GO:0005634:nucleus;	GO:0006350:transcription;GO:0007275:multicellular organismal development;GO:0009908:flower development;GO:0009909:regulation of flower development;GO:0030154:cell differentiation;GO:0045449:regulation of transcription;	GO:0003677:DNA binding;GO:0003712:transcription cofactor activity;GO:0005515:protein binding;GO:0046982:protein heterodimerization activity;	---
>prot|EG:AT1G43850.2-P|cod|AT1G43850.2-TAIR|gene|AT1G43850-TAIR-G|ann|SEU (seuss); DNA binding / protein binding / protein heterodimerization/ transcription cofactor; Encodes a transcriptional co-regulator of AGAMOUS, that functions with LEUNIG to repress AG in the outer floral whorls.	877	3	QQASDQLRQQQQQQQQQQQQQQQQQQQQQQQQTVSQ	36	77.7777777777778	24	0.666666666666667	582	617	66	SRETRTGPIESLAKFPRRTGPSSALPGPSP	NTNSDQSSRQVALMQGNPSNGVNYAFNAAS	GO:0005634:nucleus;	GO:0006350:transcription;GO:0007275:multicellular organismal development;GO:0009908:flower development;GO:0009909:regulation of flower development;GO:0030154:cell differentiation;GO:0045449:regulation of transcription;	GO:0003677:DNA binding;GO:0003712:transcription cofactor activity;GO:0005515:protein binding;GO:0046982:protein heterodimerization activity;	---
>prot|EG:AT2G25890.1-P|cod|AT2G25890.1-TAIR|gene|AT2G25890-TAIR-G|ann|glycine-rich protein / oleosin; glycine-rich protein / oleosin; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: lipid storage; LOCATED IN: monolayer-surrounded lipid storage body, integral to membrane, membrane; EXPRESSED IN: leaf whorl, petal, flower, carpel; EXPRESSED DURING: 4 anthesis, petal differentiation and expansion stage; CONTAINS InterPro DOMAIN/s: Oleosin (InterPro:IPR000136); BEST Arabidopsis thaliana protein match is: OLEO1 (OLEOSIN 1) (TAIR:AT4G25140.1); Has 402 Blast hits to 402 proteins in 48 species: Archae - 0; Bacteria - 4; Metazoa - 0; Fungi - 0; Plants - 398; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink).	149	1	QQHQQQQQ	8	87.5	5	0.625	5	12	3	MADHQQHQQQQQPIMRSLHESSPSTRQIVR	PIMRSLHESSPSTRQIVRFVTAATIGLSLL	GO:0005575:cellular_component;GO:0005811:lipid particle;GO:0012511:monolayer-surrounded lipid storage body;GO:0016020:membrane;GO:0016021:integral to membrane;	GO:0008150:biological_process;GO:0019915:lipid storage;	GO:0003674:molecular_function;	---
>prot|EG:AT4G37130.1-P|cod|AT4G37130.1-TAIR|gene|AT4G37130-TAIR-G|ann|hydroxyproline-rich glycoprotein family protein; hydroxyproline-rich glycoprotein family protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; EXPRESSED IN: 22 plant structures; EXPRESSED DURING: 13 growth stages; Has 28754 Blast hits to 10910 proteins in 570 species: Archae - 13; Bacteria - 821; Metazoa - 8015; Fungi - 3269; Plants - 2417; Viruses - 369; Other Eukaryotes - 13850 (source: NCBI BLink).	513	2	QPQQQQQ	7	85.7142857142857	5	0.714285714285714	59	65	11	TNSIFSQSQPQQTNSIFSQSQPQQTNSIFS	TSLFQPQQFQQQQQQLNQQQQQQVQQQLYL	---	GO:0008150:biological_process;	GO:0003674:molecular_function;	---
>prot|EG:AT4G37130.1-P|cod|AT4G37130.1-TAIR|gene|AT4G37130-TAIR-G|ann|hydroxyproline-rich glycoprotein family protein; hydroxyproline-rich glycoprotein family protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; EXPRESSED IN: 22 plant structures; EXPRESSED DURING: 13 growth stages; Has 28754 Blast hits to 10910 proteins in 570 species: Archae - 13; Bacteria - 821; Metazoa - 8015; Fungi - 3269; Plants - 2417; Viruses - 369; Other Eukaryotes - 13850 (source: NCBI BLink).	513	2	QPQQFQQQQQQLNQQQQQQVQQQ	23	78.2608695652174	6	0.260869565217391	70	92	13	QTNSIFSQSQPQQTNSIFSQPQQQQQTSLF	LYLFTNDKAPANYSTKWADLHPDSQKLLLQ	---	GO:0008150:biological_process;	GO:0003674:molecular_function;	---
>prot|EG:AT4G31200.3-P|cod|AT4G31200.3-TAIR|gene|AT4G31200-TAIR-G|ann|SWAP (Suppressor-of-White-APricot)/surp domain-containing protein; SWAP (Suppressor-of-White-APricot)/surp domain-containing protein; FUNCTIONS IN: RNA binding; INVOLVED IN: RNA processing; LOCATED IN: cellular_component unknown; EXPRESSED IN: 23 plant structures; EXPRESSED DURING: 13 growth stages; CONTAINS InterPro DOMAIN/s: SWAP/Surp (InterPro:IPR000061), Regulation of nuclear pre-mRNA protein (InterPro:IPR006569); Has 14318 Blast hits to 9470 proteins in 529 species: Archae - 6; Bacteria - 561; Metazoa - 6216; Fungi - 2574; Plants - 2742; Viruses - 216; Other Eukaryotes - 2003 (source: NCBI BLink).	650	2	QQQQQQ	6	100	6	1	18	23	2	MDRRQHDYAASSGLPYAQQQQQQGPNFQQQ	GPNFQQQQQPQFGFHPQHPQYPSPMNASGF	GO:0005575:cellular_component;	GO:0006396:RNA processing;	GO:0003723:RNA binding;	---
>prot|EG:AT4G31200.3-P|cod|AT4G31200.3-TAIR|gene|AT4G31200-TAIR-G|ann|SWAP (Suppressor-of-White-APricot)/surp domain-containing protein; SWAP (Suppressor-of-White-APricot)/surp domain-containing protein; FUNCTIONS IN: RNA binding; INVOLVED IN: RNA processing; LOCATED IN: cellular_component unknown; EXPRESSED IN: 23 plant structures; EXPRESSED DURING: 13 growth stages; CONTAINS InterPro DOMAIN/s: SWAP/Surp (InterPro:IPR000061), Regulation of nuclear pre-mRNA protein (InterPro:IPR006569); Has 14318 Blast hits to 9470 proteins in 529 species: Archae - 6; Bacteria - 561; Metazoa - 6216; Fungi - 2574; Plants - 2742; Viruses - 216; Other Eukaryotes - 2003 (source: NCBI BLink).	650	2	QQQQQPQ	7	85.7142857142857	5	0.714285714285714	28	34	4	MDRRQHDYAASSGLPYAQQQQQQGPNFQQQ	FGFHPQHPQYPSPMNASGFIPPHPSMQQFP	GO:0005575:cellular_component;	GO:0006396:RNA processing;	GO:0003723:RNA binding;	---
>prot|EG:AT4G29230.1-P|cod|AT4G29230.1-TAIR|gene|AT4G29230-TAIR-G|ann|anac075 (Arabidopsis NAC domain containing protein 75); transcription factor; Arabidopsis NAC domain containing protein 75 (anac075); FUNCTIONS IN: transcription factor activity; INVOLVED IN: multicellular organismal development, regulation of transcription; EXPRESSED IN: inflorescence meristem, flower; EXPRESSED DURING: petal differentiation and expansion stage; CONTAINS InterPro DOMAIN/s: No apical meristem (NAM) protein (InterPro:IPR003441); BEST Arabidopsis thaliana protein match is: anac099 (Arabidopsis NAC domain containing protein 99); transcription factor (TAIR:AT5G56620.1); Has 1978 Blast hits to 1845 proteins in 148 species: Archae - 0; Bacteria - 17; Metazoa - 479; Fungi - 50; Plants - 1218; Viruses - 3; Other Eukaryotes - 211 (source: NCBI BLink).	498	1	QQQQQ	5	100	5	1	367	371	73	DVMAEQHRHRHQPSSSTSHHMAHDHHHHHH	RHHAFNISQPTHPISTIISPSTSLHHASIN	GO:0016020:membrane;	GO:0007275:multicellular organismal development;GO:0045449:regulation of transcription;GO:0051260:protein homooligomerization;	GO:0003677:DNA binding;GO:0003700:sequence-specific DNA binding transcription factor activity;	---
>prot|EG:AT3G10960.1-P|cod|AT3G10960.1-TAIR|gene|AT3G10960-TAIR-G|ann|xanthine/uracil permease family protein; xanthine/uracil permease family protein; FUNCTIONS IN: transmembrane transporter activity, transporter activity; INVOLVED IN: transport; LOCATED IN: membrane; EXPRESSED IN: 22 plant structures; EXPRESSED DURING: 13 growth stages; CONTAINS InterPro DOMAIN/s: Xanthine/uracil/vitamin C permease (InterPro:IPR006043); BEST Arabidopsis thaliana protein match is: xanthine/uracil/vitamin C permease family protein (TAIR:AT5G50300.1); Has 4931 Blast hits to 4928 proteins in 986 species: Archae - 54; Bacteria - 3052; Metazoa - 8; Fungi - 78; Plants - 33; Viruses - 0; Other Eukaryotes - 1706 (source: NCBI BLink).	579	1	QQQQQQ	6	100	6	1	3	8	0	MEQQQQQQLPSTTTRPKPKLLNRLNTYVGS	LPSTTTRPKPKLLNRLNTYVGSSRVGKRFK	GO:0016020:membrane;	GO:0006810:transport;GO:0015853:adenine transport;GO:0015854:guanine transport;	GO:0005215:transporter activity;GO:0022857:transmembrane transporter activity;	---
>prot|EG:AT2G31370.5-P|cod|AT2G31370.5-TAIR|gene|AT2G31370-TAIR-G|ann|bZIP transcription factor (POSF21); bZIP transcription factor (POSF21); FUNCTIONS IN: transcription factor activity, DNA binding; INVOLVED IN: regulation of transcription, DNA-dependent; LOCATED IN: nucleus; EXPRESSED IN: 22 plant structures; EXPRESSED DURING: 13 growth stages; CONTAINS InterPro DOMAIN/s: Basic-leucine zipper (bZIP) transcription factor (InterPro:IPR004827), Basic leucine zipper (InterPro:IPR011700); BEST Arabidopsis thaliana protein match is: bZIP transcription factor, putative (bZIP69) (TAIR:AT1G06070.1); Has 54269 Blast hits to 19856 proteins in 831 species: Archae - 14; Bacteria - 2070; Metazoa - 21047; Fungi - 5854; Plants - 2899; Viruses - 481; Other Eukaryotes - 21904 (source: NCBI BLink).	377	1	QKQQQQQQQQQ	11	90.9090909090909	9	0.818181818181818	340	350	90	GSNQQQFYSNNQSMQTILAAKQFQQLQIHS	HNSISFNSNRCNSLCSSGFNSKNNKME	GO:0005634:nucleus;	GO:0006350:transcription;GO:0006355:regulation of transcription, DNA-dependent;GO:0045449:regulation of transcription;	GO:0003677:DNA binding;GO:0003700:sequence-specific DNA binding transcription factor activity;GO:0043565:sequence-specific DNA binding;GO:0046983:protein dimerization activity;	---
>prot|EG:AT1G30330.1-P|cod|AT1G30330.1-TAIR|gene|AT1G30330-TAIR-G|ann|ARF6 (AUXIN RESPONSE FACTOR 6); transcription factor; Encodes a member of the auxin response factor family. Mediates auxin response via expression of auxin regulated genes. Acts redundantly with ARF8 to control stamen elongation and flower maturation. Expression of ARF6 is controlled by miR167.	933	2	QQQQQLSQQQQQQQQLSQQQQQQLSQQQQQQLSQQQQQQLSQQQQQQ	47	78.7234042553192	8	0.170212765957447	488	534	52	ASLLQFQNSPGFSMQSPSLVQPQMLQQQLS	AYLGVPETHQPQSQAQSQSNNHLSQQQQQV	GO:0005634:nucleus;	GO:0006350:transcription;GO:0006355:regulation of transcription, DNA-dependent;GO:0009725:response to hormone stimulus;GO:0009733:response to auxin stimulus;GO:0009734:auxin mediated signaling pathway;GO:0009908:flower development;GO:0045449:regulation of transcription;	GO:0003677:DNA binding;GO:0003700:sequence-specific DNA binding transcription factor activity;GO:0046983:protein dimerization activity;	---
>prot|EG:AT1G30330.1-P|cod|AT1G30330.1-TAIR|gene|AT1G30330-TAIR-G|ann|ARF6 (AUXIN RESPONSE FACTOR 6); transcription factor; Encodes a member of the auxin response factor family. Mediates auxin response via expression of auxin regulated genes. Acts redundantly with ARF8 to control stamen elongation and flower maturation. Expression of ARF6 is controlled by miR167.	933	2	QQQQQ	5	100	5	1	559	563	59	QQQQQQAYLGVPETHQPQSQAQSQSNNHLS	VVDNHNPSASSAAVVSAMSQFGSASQPNTS	GO:0005634:nucleus;	GO:0006350:transcription;GO:0006355:regulation of transcription, DNA-dependent;GO:0009725:response to hormone stimulus;GO:0009733:response to auxin stimulus;GO:0009734:auxin mediated signaling pathway;GO:0009908:flower development;GO:0045449:regulation of transcription;	GO:0003677:DNA binding;GO:0003700:sequence-specific DNA binding transcription factor activity;GO:0046983:protein dimerization activity;	---
>prot|EG:AT5G12120.1-P|cod|AT5G12120.1-TAIR|gene|AT5G12120-TAIR-G|ann|ubiquitin-associated (UBA)/TS-N domain-containing protein; ubiquitin-associated (UBA)/TS-N domain-containing protein; INVOLVED IN: biological_process unknown; LOCATED IN: plasma membrane; EXPRESSED IN: 24 plant structures; EXPRESSED DURING: 15 growth stages; CONTAINS InterPro DOMAIN/s: Ubiquitin-associated/translation elongation factor EF1B, N-terminal (InterPro:IPR000449), Ubiquitin-associated/translation elongation factor EF1B, N-terminal, eukaryote (InterPro:IPR015940); BEST Arabidopsis thaliana protein match is: ubiquitin-associated (UBA)/TS-N domain-containing protein (TAIR:AT2G26920.1); Has 346 Blast hits to 332 proteins in 63 species: Archae - 0; Bacteria - 2; Metazoa - 124; Fungi - 55; Plants - 32; Viruses - 0; Other Eukaryotes - 133 (source: NCBI BLink).	619	1	QQQQQQQQRSQ	11	81.8181818181818	8	0.727272727272727	398	408	64	STEETHYVTALGDQFKRLQQQDMREPVMVM	SANTNVLPVSTMNASFTGAAAAGSGWHPAN	GO:0005886:plasma membrane;	GO:0008150:biological_process;	---	---
>prot|EG:AT1G61660.2-P|cod|AT1G61660.2-TAIR|gene|AT1G61660-TAIR-G|ann|basic helix-loop-helix (bHLH) family protein; basic helix-loop-helix (bHLH) family protein; FUNCTIONS IN: transcription factor activity, DNA binding; INVOLVED IN: regulation of transcription; LOCATED IN: nucleus; EXPRESSED IN: 22 plant structures; EXPRESSED DURING: 13 growth stages; CONTAINS InterPro DOMAIN/s: Basic helix-loop-helix dimerisation region bHLH (InterPro:IPR001092), Helix-loop-helix DNA-binding (InterPro:IPR011598); BEST Arabidopsis thaliana protein match is: ethylene-responsive protein -related (TAIR:AT3G20640.1); Has 1231 Blast hits to 803 proteins in 74 species: Archae - 0; Bacteria - 54; Metazoa - 297; Fungi - 43; Plants - 548; Viruses - 0; Other Eukaryotes - 289 (source: NCBI BLink).	347	1	QQQQQVQ	7	85.7142857142857	5	0.714285714285714	338	344	97	VLQEAIEYIKFLHDQVTVLSTPYMKQGASN	YTI	GO:0005634:nucleus;	GO:0006350:transcription;GO:0045449:regulation of transcription;	GO:0003677:DNA binding;GO:0003700:sequence-specific DNA binding transcription factor activity;GO:0030528:transcription regulator activity;	---
>prot|EG:AT1G12860.1-P|cod|AT1G12860.1-TAIR|gene|AT1G12860-TAIR-G|ann|SCRM2 (SCREAM 2); DNA binding / transcription factor; Encodes ICE2 (Inducer of CBF Expression 2), a transcription factor of the bHLH family that participates in the response to deep freezing through the cold acclimation-dependent pathway. Overexpression of ICE2 results in increased tolerance to deep freezing stress after cold acclimation.	828	1	QQQQQQQQQQEQ	12	91.6666666666667	10	0.833333333333333	468	479	56	ENLLLLLQQSIDSSSSSSPLLHPFTLDAAS	SFLATKACIVSLLNVPTINNNTFDDFGFDS	GO:0005634:nucleus;GO:0009507:chloroplast;	GO:0006350:transcription;GO:0007275:multicellular organismal development;GO:0010444:guard mother cell differentiation;GO:0045449:regulation of transcription;GO:0050826:response to freezing;	GO:0003677:DNA binding;GO:0003700:sequence-specific DNA binding transcription factor activity;GO:0030528:transcription regulator activity;	---
>prot|EG:AT5G14540.1-P|cod|AT5G14540.1-TAIR|gene|AT5G14540-TAIR-G|ann|proline-rich family protein; proline-rich family protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: cellular_component unknown; EXPRESSED IN: 23 plant structures; EXPRESSED DURING: 13 growth stages; CONTAINS InterPro DOMAIN/s: Ubiquitin-associated/translation elongation factor EF1B, N-terminal, eukaryote (InterPro:IPR015940), UBA-like (InterPro:IPR009060), Protein of unknown function DUF1421 (InterPro:IPR010820); BEST Arabidopsis thaliana protein match is: proline-rich family protein (TAIR:AT3G01560.1); Has 96814 Blast hits to 50121 proteins in 1728 species: Archae - 134; Bacteria - 11167; Metazoa - 41774; Fungi - 16096; Plants - 12223; Viruses - 2174; Other Eukaryotes - 13246 (source: NCBI BLink).	547	1	QQQQQQ	6	100	6	1	533	538	97	TVRTLTENGQAVDLNVVLDKLMNGDRGAMM	PPRGWFGGR	GO:0005575:cellular_component;	GO:0008150:biological_process;	GO:0003674:molecular_function;	---
>prot|EG:AT1G06040.1-P|cod|AT1G06040.1-TAIR|gene|AT1G06040-TAIR-G|ann|STO (SALT TOLERANCE); DNA binding / protein binding / transcription factor/ zinc ion binding; Encodes salt tolerance protein (STO) which confers salt tolerance to yeast cells. Fully complements calcineurin deficient yeast but does not encode a phosphoprotein phosphatase. Sequence has similarities to CONSTANS. STO co-localizes with COP1 and plays a role in light signaling.	248	1	QQQQQ	5	100	5	1	139	143	56	TICSKEIEKNQPEPSNNQQKANQIPAKSTS	PSSATPLPWAVDDFFHFSDIESTDKKGQLD	GO:0005575:cellular_component;GO:0005622:intracellular;GO:0005634:nucleus;	GO:0006414:translational elongation;GO:0009416:response to light stimulus;GO:0009640:photomorphogenesis;GO:0009651:response to salt stress;	GO:0003677:DNA binding;GO:0003700:sequence-specific DNA binding transcription factor activity;GO:0005515:protein binding;GO:0008270:zinc ion binding;GO:0030533:triplet codon-amino acid adaptor activity;GO:0046872:metal ion binding;	---
>prot|EG:AT3G61240.2-P|cod|AT3G61240.2-TAIR|gene|AT3G61240-TAIR-G|ann|DEAD/DEAH box helicase, putative (RH12); DEAD/DEAH box helicase, putative (RH12); FUNCTIONS IN: helicase activity, ATP-dependent helicase activity, ATP binding, nucleic acid binding; EXPRESSED IN: 24 plant structures; EXPRESSED DURING: 13 growth stages; CONTAINS InterPro DOMAIN/s: RNA helicase, DEAD-box type, Q motif (InterPro:IPR014014), DNA/RNA helicase, DEAD/DEAH box type, N-terminal (InterPro:IPR011545), RNA helicase, ATP-dependent, DEAD-box, conserved site (InterPro:IPR000629), DEAD-like helicase, N-terminal (InterPro:IPR014001), DNA/RNA helicase, C-terminal (InterPro:IPR001650), Helicase, superfamily 1 and 2, ATP-binding (InterPro:IPR014021); BEST Arabidopsis thaliana protein match is: DEAD/DEAH box helicase, putative (TAIR:AT2G45810.1); Has 38149 Blast hits to 31557 proteins in 1824 species: Archae - 426; Bacteria - 11683; Metazoa - 8068; Fungi - 4281; Plants - 1592; Viruses - 82; Other Eukaryotes - 12017 (source: NCBI BLink).	498	1	QNPQQMQLQQQHQQQQQQQQ	20	75	8	0.4	46	65	9	RGAPPNPDYHQSYRQQQPPQDQQYVQRGYS	WSRRPQLPGNASNANEVVQQTTQPEASSDA	GO:0000932:cytoplasmic mRNA processing body;GO:0005737:cytoplasm;	GO:0006397:mRNA processing;GO:0006417:regulation of translation;GO:0006810:transport;GO:0051028:mRNA transport;	GO:0000166:nucleotide binding;GO:0003676:nucleic acid binding;GO:0003723:RNA binding;GO:0004386:helicase activity;GO:0005524:ATP binding;GO:0008026:ATP-dependent helicase activity;GO:0016787:hydrolase activity;	---
>prot|EG:AT1G01260.2-P|cod|AT1G01260.2-TAIR|gene|AT1G01260-TAIR-G|ann|basic helix-loop-helix (bHLH) family protein; basic helix-loop-helix (bHLH) family protein; FUNCTIONS IN: transcription factor activity, DNA binding; INVOLVED IN: regulation of transcription; LOCATED IN: nucleus; EXPRESSED IN: 24 plant structures; EXPRESSED DURING: 15 growth stages; CONTAINS InterPro DOMAIN/s: Basic helix-loop-helix dimerisation region bHLH (InterPro:IPR001092), Helix-loop-helix DNA-binding (InterPro:IPR011598); BEST Arabidopsis thaliana protein match is: ATAIB (ABA-INDUCIBLE BHLH-TYPE TRANSCRIPTION FACTOR); DNA binding / transcription factor (TAIR:AT2G46510.1); Has 2098 Blast hits to 1892 proteins in 178 species: Archae - 0; Bacteria - 2; Metazoa - 163; Fungi - 52; Plants - 1843; Viruses - 0; Other Eukaryotes - 38 (source: NCBI BLink).	590	1	QQQQQQ	6	100	6	1	281	286	47	TVAEKIDDNRTKIFGKDLHNSGFLQHHQHH	PPQQQQHRQFREKLTVRKMDDRAPKRLDAY	GO:0005634:nucleus;	GO:0006350:transcription;GO:0045449:regulation of transcription;	GO:0003677:DNA binding;GO:0003700:sequence-specific DNA binding transcription factor activity;GO:0030528:transcription regulator activity;	---
>prot|EG:AT3G05220.2-P|cod|AT3G05220.2-TAIR|gene|AT3G05220-TAIR-G|ann|heavy-metal-associated domain-containing protein; heavy-metal-associated domain-containing protein; FUNCTIONS IN: metal ion binding; INVOLVED IN: metal ion transport; EXPRESSED IN: 23 plant structures; EXPRESSED DURING: 13 growth stages; CONTAINS InterPro DOMAIN/s: Heavy metal transport/detoxification protein (InterPro:IPR006121); BEST Arabidopsis thaliana protein match is: heavy-metal-associated domain-containing protein (TAIR:AT3G06130.1); Has 94403 Blast hits to 32943 proteins in 1457 species: Archae - 110; Bacteria - 18725; Metazoa - 39578; Fungi - 5365; Plants - 8399; Viruses - 1494; Other Eukaryotes - 20732 (source: NCBI BLink).	478	1	QQQQQQQQQQ	10	100	10	1	410	419	85	PMSGGGGYYPGPPQASQQMNQQQYMQMMMN	AVAHGGYGGGHGGDMYHPMMYARPYPAVNY	---	GO:0030001:metal ion transport;	GO:0046872:metal ion binding;	---
>prot|EG:AT4G16563.1-P|cod|AT4G16563.1-TAIR|gene|AT4G16563-TAIR-G|ann|aspartyl protease family protein; aspartyl protease family protein; FUNCTIONS IN: aspartic-type endopeptidase activity; INVOLVED IN: proteolysis; LOCATED IN: plant-type cell wall; EXPRESSED IN: 19 plant structures; EXPRESSED DURING: 11 growth stages; CONTAINS InterPro DOMAIN/s: Peptidase aspartic, catalytic (InterPro:IPR009007), Peptidase A1 (InterPro:IPR001461), Peptidase aspartic, active site (InterPro:IPR001969); BEST Arabidopsis thaliana protein match is: aspartyl protease family protein (TAIR:AT5G45120.1); Has 1308 Blast hits to 1249 proteins in 96 species: Archae - 0; Bacteria - 0; Metazoa - 90; Fungi - 75; Plants - 1069; Viruses - 0; Other Eukaryotes - 74 (source: NCBI BLink).	499	1	QQQQQ	5	100	5	1	68	72	13	STSKHSSSPLHLLKSSSSRSSARFRRHHHK	LSLPISSGSDYLISLSVGSSSSAVSLYLDT	GO:0009505:plant-type cell wall;	GO:0006508:proteolysis;	GO:0004190:aspartic-type endopeptidase activity;GO:0008233:peptidase activity;GO:0016787:hydrolase activity;	---
>prot|EG:AT3G06480.1-P|cod|AT3G06480.1-TAIR|gene|AT3G06480-TAIR-G|ann|DEAD box RNA helicase, putative; DEAD box RNA helicase, putative; FUNCTIONS IN: protein binding, helicase activity, nucleic acid binding, ATP binding, ATP-dependent helicase activity; INVOLVED IN: biological_process unknown; LOCATED IN: vacuole; EXPRESSED IN: 24 plant structures; EXPRESSED DURING: 15 growth stages; CONTAINS InterPro DOMAIN/s: DNA/RNA helicase, DEAD/DEAH box type, N-terminal (InterPro:IPR011545), RNA helicase, ATP-dependent, DEAD-box, conserved site (InterPro:IPR000629), RNA helicase, DEAD-box type, Q motif (InterPro:IPR014014), WW/Rsp5/WWP (InterPro:IPR001202), DEAD-like helicase, N-terminal (InterPro:IPR014001), DNA/RNA helicase, C-terminal (InterPro:IPR001650), Helicase, superfamily 1 and 2, ATP-binding (InterPro:IPR014021); BEST Arabidopsis thaliana protein match is: DRH1 (DEAD BOX RNA HELICASE 1); ATP-dependent RNA helicase/ ATPase (TAIR:AT3G01540.4); Has 109211 Blast hits to 62170 proteins in 2363 species: Archae - 554; Bacteria - 31458; Metazoa - 36250; Fungi - 10201; Plants - 9855; Viruses - 839; Other Eukaryotes - 20054 (source: NCBI BLink).	1088	1	QQQQQ	5	100	5	1	155	159	14	SGQQFPQQQSQSMVPHPHGHPSVQTYQPTT	GMQNQHSQMPQQLSHQYAHSQQHYMGFRPH	GO:0005634:nucleus;GO:0005773:vacuole;	GO:0000184:nuclear-transcribed mRNA catabolic process, nonsense-mediated decay;GO:0006364:rRNA processing;GO:0008150:biological_process;GO:0042254:ribosome biogenesis;	GO:0000166:nucleotide binding;GO:0003676:nucleic acid binding;GO:0003723:RNA binding;GO:0004386:helicase activity;GO:0005515:protein binding;GO:0005524:ATP binding;GO:0008026:ATP-dependent helicase activity;GO:0016787:hydrolase activity;	---
>prot|EG:AT5G66850.1-P|cod|AT5G66850.1-TAIR|gene|AT5G66850-TAIR-G|ann|MAPKKK5; ATP binding / kinase/ protein kinase/ protein serine/threonine kinase; member of MEKK subfamily	716	1	QQQQQQQ	7	100	7	1	662	668	92	EPSSRREKPNFKLDQVPRARNMTSSESESG	YRSPDLTGTVNRLSPRSTLEAIPSPCPSQR	GO:0005886:plasma membrane;	GO:0006468:protein amino acid phosphorylation;	GO:0000166:nucleotide binding;GO:0004672:protein kinase activity;GO:0004674:protein serine/threonine kinase activity;GO:0004713:protein tyrosine kinase activity;GO:0005524:ATP binding;GO:0016301:kinase activity;	---
>prot|EG:AT5G54900.1-P|cod|AT5G54900.1-TAIR|gene|AT5G54900-TAIR-G|ann|ATRBP45A (RNA-binding protein 45A); RNA binding; RNA-binding protein 45A (ATRBP45A); FUNCTIONS IN: RNA binding; EXPRESSED IN: 24 plant structures; EXPRESSED DURING: 14 growth stages; CONTAINS InterPro DOMAIN/s: RNA recognition motif, RNP-1 (InterPro:IPR000504), Nucleotide-binding, alpha-beta plait (InterPro:IPR012677); BEST Arabidopsis thaliana protein match is: ATRBP45C; RNA binding (TAIR:AT4G27000.1); Has 26274 Blast hits to 15473 proteins in 616 species: Archae - 10; Bacteria - 1663; Metazoa - 15334; Fungi - 2743; Plants - 3912; Viruses - 0; Other Eukaryotes - 2612 (source: NCBI BLink).	387	1	QQQQQQQQMQ	10	90	8	0.8	26	35	6	MQQPPSNAAGAGQIPSGQQHLWMMMQQQQQ	LSAAPLGQHQYGIGSQNPGSASDVKSLWIG	---	---	GO:0000166:nucleotide binding;GO:0003676:nucleic acid binding;GO:0003723:RNA binding;	---
>prot|EG:AT4G24370.1-P|cod|AT4G24370.1-TAIR|gene|AT4G24370-TAIR-G|ann|unknown protein; unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: cellular_component unknown; EXPRESSED IN: 23 plant structures; EXPRESSED DURING: 13 growth stages; Has 22 Blast hits to 22 proteins in 9 species: Archae - 0; Bacteria - 0; Metazoa - 2; Fungi - 0; Plants - 14; Viruses - 0; Other Eukaryotes - 6 (source: NCBI BLink).	164	1	QQQQQKQ	7	85.7142857142857	5	0.714285714285714	59	65	35	DSHTSRSSSDYLDPDLHSRFLALKSQKKKD	RPRMQPKSKDVVEETPEDLMLRFAALKTSL	GO:0005575:cellular_component;	GO:0008150:biological_process;	GO:0003674:molecular_function;	---
>prot|EG:AT1G13960.2-P|cod|AT1G13960.2-TAIR|gene|AT1G13960-TAIR-G|ann|WRKY4; DNA binding / transcription factor; Encodes WRKY DNA-binding protein 4 (WRKY4).	487	1	QQQQQQ	6	100	6	1	469	474	96	DLPAAKSSSHAAAAAQLRPDNRPGGLANLN	PVARLRLKEEQTT	GO:0005634:nucleus;GO:0009507:chloroplast;	GO:0006350:transcription;GO:0006355:regulation of transcription, DNA-dependent;GO:0007275:multicellular organismal development;GO:0045449:regulation of transcription;	GO:0003677:DNA binding;GO:0003700:sequence-specific DNA binding transcription factor activity;GO:0004871:signal transducer activity;GO:0043565:sequence-specific DNA binding;	---
>prot|EG:AT5G59430.3-P|cod|AT5G59430.3-TAIR|gene|AT5G59430-TAIR-G|ann|TRP1 (TELOMERIC REPEAT BINDING PROTEIN 1); DNA binding / double-stranded telomeric DNA binding; Encodes a telomeric repeat binding protein with a DNA binding domain at its C terminus. The DNA binding domain has a preference for GGTTTAG sequences and at least five of these repeats are required for recognition by a nearly full-length TRP1 protein.	568	1	QQQQQAAQ	8	75	5	0.625	457	464	80	TEDSKAMISVALNELSSQSQPPSRKSRRSE	RRIRRPFSVAEVEALVQAVEKLGTGRWRDV	GO:0005634:nucleus;	GO:0009651:response to salt stress;GO:0009723:response to ethylene stimulus;GO:0009733:response to auxin stimulus;GO:0009739:response to gibberellin stimulus;GO:0009751:response to salicylic acid stimulus;GO:0009753:response to jasmonic acid stimulus;GO:0045449:regulation of transcription;GO:0046686:response to cadmium ion;	GO:0003677:DNA binding;GO:0003691:double-stranded telomeric DNA binding;GO:0005515:protein binding;	---
>prot|EG:AT3G54220.1-P|cod|AT3G54220.1-TAIR|gene|AT3G54220-TAIR-G|ann|SCR (SCARECROW); protein binding / protein homodimerization/ sequence-specific DNA binding / transcription factor; Encodes a member of a novel family having similarity to DNA binding proteins containing basic-leucine zipper regions; scr is expressed in cortex/endodermal initial cells and in the endodermal cell lineage. Regulates the radial organization of the root. Is required cell-autonomously for distal specification of the quiescent center, which in turn regulates stem cell fate of immediately surrounding cells. SCR appears to be a direct target of SHR.	653	1	QQQQQHQQQQQQ	12	91.6666666666667	6	0.5	218	229	33	LMLLDPSSSSDPSPQTFEPLYQISNNPSPP	HKPPPPPIQQQERENSSTDAPPQPETVTAT	GO:0005634:nucleus;	GO:0006350:transcription;GO:0007275:multicellular organismal development;GO:0008356:asymmetric cell division;GO:0009630:gravitropism;GO:0009956:radial pattern formation;GO:0045449:regulation of transcription;GO:0051457:maintenance of protein location in nucleus;	GO:0003700:sequence-specific DNA binding transcription factor activity;GO:0005515:protein binding;GO:0043565:sequence-specific DNA binding;	---
>prot|EG:AT5G08190.1-P|cod|AT5G08190.1-TAIR|gene|AT5G08190-TAIR-G|ann|NF-YB12 (NUCLEAR FACTOR Y, SUBUNIT B12); DNA binding / transcription factor; NUCLEAR FACTOR Y, SUBUNIT B12 (NF-YB12); FUNCTIONS IN: transcription factor activity, DNA binding; INVOLVED IN: regulation of transcription; LOCATED IN: intracellular; EXPRESSED IN: 24 plant structures; EXPRESSED DURING: 14 growth stages; CONTAINS InterPro DOMAIN/s: Transcription factor CBF/NF-Y/archaeal histone (InterPro:IPR003958), Histone-fold (InterPro:IPR009072); BEST Arabidopsis thaliana protein match is: NF-YB13 (NUCLEAR FACTOR Y, SUBUNIT B13); transcription factor (TAIR:AT5G23090.2); Has 985 Blast hits to 985 proteins in 178 species: Archae - 0; Bacteria - 0; Metazoa - 382; Fungi - 235; Plants - 292; Viruses - 0; Other Eukaryotes - 76 (source: NCBI BLink).	163	1	QQQQQ	5	100	5	1	154	158	94	AAEQQRMFAEARARMNGGVTVPQPEQLEEP	TSLQS	GO:0005622:intracellular;GO:0005634:nucleus;	GO:0045449:regulation of transcription;	GO:0003677:DNA binding;GO:0003700:sequence-specific DNA binding transcription factor activity;GO:0043565:sequence-specific DNA binding;	---
>prot|EG:AT2G30590.1-P|cod|AT2G30590.1-TAIR|gene|AT2G30590-TAIR-G|ann|WRKY21; calmodulin binding / transcription factor; Encodes WRKY DNA-binding protein 21 (WRKY21).	380	1	QQQQQQQQQQQQQEQQQQQQQQQQQ	25	96	13	0.52	154	178	40	FSLNSNAKAPLLQLNQQTMPPSNYPTLFPV	FHERLQAHHLHQQQQLQKHQAELMLRKCNG	GO:0005634:nucleus;	GO:0006350:transcription;GO:0006355:regulation of transcription, DNA-dependent;GO:0045449:regulation of transcription;	GO:0003677:DNA binding;GO:0003700:sequence-specific DNA binding transcription factor activity;GO:0005515:protein binding;GO:0005516:calmodulin binding;GO:0043565:sequence-specific DNA binding;	---
>prot|EG:AT5G13330.1-P|cod|AT5G13330.1-TAIR|gene|AT5G13330-TAIR-G|ann|Rap2.6L (related to AP2 6L); DNA binding / transcription factor; encodes a member of the ERF (ethylene response factor) subfamily B-4 of ERF/AP2 transcription factor family. The protein contains one AP2 domain. There are 7 members in this subfamily.	212	1	QQTQQQQLQQQQQQ	14	85.7142857142857	6	0.428571428571429	181	194	85	TSNNEVDLSYYTSTLFSQPFSTPSSSSSSS	REEEEKNYGYNYYNYPRE	GO:0005634:nucleus;	GO:0006350:transcription;GO:0006355:regulation of transcription, DNA-dependent;GO:0009873:ethylene mediated signaling pathway;GO:0045449:regulation of transcription;	GO:0003677:DNA binding;GO:0003700:sequence-specific DNA binding transcription factor activity;	---
>prot|EG:AT3G11020.1-P|cod|AT3G11020.1-TAIR|gene|AT3G11020-TAIR-G|ann|DREB2B (DRE/CRT-BINDING PROTEIN 2B); DNA binding / transcription activator/ transcription factor; encodes a member of the DREB subfamily A-2 of ERF/AP2 transcription factor family (DREB2B). The protein contains one AP2 domain. There are eight members in this subfamily including DREB2A.	330	1	QQQQQEQQQQQLQ	13	84.6153846153846	5	0.384615384615385	237	249	71	NYDLLLEFEQQYWGQVLQEKEKPKQEEEEI	PDLLTVADYGWPWSNDIVNDQTSWDPNECF	GO:0005634:nucleus;	GO:0006350:transcription;GO:0006355:regulation of transcription, DNA-dependent;GO:0006950:response to stress;GO:0009414:response to water deprivation;GO:0010286:heat acclimation;GO:0045449:regulation of transcription;	GO:0003677:DNA binding;GO:0003700:sequence-specific DNA binding transcription factor activity;GO:0016563:transcription activator activity;	---
>prot|EG:AT3G46920.1-P|cod|AT3G46920.1-TAIR|gene|AT3G46920-TAIR-G|ann|protein kinase family protein; protein kinase family protein; FUNCTIONS IN: protein serine/threonine/tyrosine kinase activity, protein kinase activity; INVOLVED IN: protein amino acid phosphorylation; LOCATED IN: chloroplast; EXPRESSED IN: 21 plant structures; EXPRESSED DURING: 10 growth stages; CONTAINS InterPro DOMAIN/s: Octicosapeptide/Phox/Bem1p (InterPro:IPR000270), Protein kinase, ATP binding site (InterPro:IPR017441), Protein kinase, core (InterPro:IPR000719), Tyrosine protein kinase (InterPro:IPR001245), Protein kinase-like (InterPro:IPR011009), Serine/threonine protein kinase, active site (InterPro:IPR008271); BEST Arabidopsis thaliana protein match is: protein kinase family protein (TAIR:AT1G16270.1); Has 83354 Blast hits to 82275 proteins in 3383 species: Archae - 53; Bacteria - 6385; Metazoa - 38452; Fungi - 6355; Plants - 17795; Viruses - 390; Other Eukaryotes - 13924 (source: NCBI BLink).	1171	1	QQQQQ	5	100	5	1	304	308	25	AYVVPMTVHADPPHSFQLETVSEKPIVGKM	GYTTPSEHHPPAYVESRQEALRQPDIVHSP	GO:0009507:chloroplast;	GO:0006468:protein amino acid phosphorylation;	GO:0000166:nucleotide binding;GO:0004672:protein kinase activity;GO:0004674:protein serine/threonine kinase activity;GO:0004712:protein serine/threonine/tyrosine kinase activity;GO:0004713:protein tyrosine kinase activity;GO:0005524:ATP binding;	---
>prot|EG:AT3G45850.1-P|cod|AT3G45850.1-TAIR|gene|AT3G45850-TAIR-G|ann|kinesin motor protein-related; kinesin motor protein-related; FUNCTIONS IN: microtubule motor activity, ATP binding; INVOLVED IN: microtubule-based movement; LOCATED IN: plasma membrane; EXPRESSED IN: 23 plant structures; EXPRESSED DURING: 13 growth stages; CONTAINS InterPro DOMAIN/s: Kinesin, motor region (InterPro:IPR001752); BEST Arabidopsis thaliana protein match is: kinesin motor protein-related (TAIR:AT2G28620.1); Has 51195 Blast hits to 33804 proteins in 1398 species: Archae - 511; Bacteria - 4991; Metazoa - 25409; Fungi - 4042; Plants - 2382; Viruses - 131; Other Eukaryotes - 13729 (source: NCBI BLink).	1058	1	QQQQQQQQ	8	100	8	1	1027	1034	97	IEELRTPASEELLRAFRDEKLSKQANGDAK	HLIRASSLYEAAVSDSRYPLSAVN	GO:0005874:microtubule;GO:0005886:plasma membrane;	GO:0007018:microtubule-based movement;	GO:0000166:nucleotide binding;GO:0003774:motor activity;GO:0003777:microtubule motor activity;GO:0005524:ATP binding;	---
>prot|EG:AT1G17370.1-P|cod|AT1G17370.1-TAIR|gene|AT1G17370-TAIR-G|ann|UBP1B (oligouridylate binding protein 1B); mRNA 3'-UTR binding; oligouridylate binding protein 1B (UBP1B); FUNCTIONS IN: mRNA 3'-UTR binding; EXPRESSED IN: 23 plant structures; EXPRESSED DURING: 13 growth stages; CONTAINS InterPro DOMAIN/s: RNA recognition motif, RNP-1 (InterPro:IPR000504), Nucleotide-binding, alpha-beta plait (InterPro:IPR012677); BEST Arabidopsis thaliana protein match is: oligouridylate-binding protein, putative (TAIR:AT3G14100.1); Has 17907 Blast hits to 12570 proteins in 534 species: Archae - 0; Bacteria - 870; Metazoa - 10427; Fungi - 2031; Plants - 2891; Viruses - 0; Other Eukaryotes - 1688 (source: NCBI BLink).	419	1	QQQQQQQ	7	100	7	1	6	12	1	MQRLKQQQQQQQVMMQQALMQQQSLYHPGL	VMMQQALMQQQSLYHPGLLAPPQIEPIPSG	---	---	GO:0000166:nucleotide binding;GO:0003676:nucleic acid binding;GO:0003730:mRNA 3'-UTR binding;	---
>prot|EG:AT4G37650.1-P|cod|AT4G37650.1-TAIR|gene|AT4G37650-TAIR-G|ann|SHR (SHORT ROOT); protein binding / sequence-specific DNA binding / transcription factor; Involved in radial organization of the root and shoot axial organs. Essential for normal shoot gravitropism. The protein moves in a highly specific manner from the cells of the stele in which it is synthesized outward. Movement requires sequences within the GRAS and VHIID domains.	531	1	QQQQQ	5	100	5	1	11	15	2	MDTLFRLVSLQQQQQSDSIITNQSSLSRTS	SDSIITNQSSLSRTSTTTTGSPQTAYHYNF	GO:0005634:nucleus;GO:0005737:cytoplasm;	GO:0006350:transcription;GO:0007275:multicellular organismal development;GO:0008356:asymmetric cell division;GO:0009956:radial pattern formation;GO:0032350:regulation of hormone metabolic process;GO:0045449:regulation of transcription;	GO:0003700:sequence-specific DNA binding transcription factor activity;GO:0005515:protein binding;GO:0043565:sequence-specific DNA binding;	---
>prot|EG:AT1G70280.1-P|cod|AT1G70280.1-TAIR|gene|AT1G70280-TAIR-G|ann|NHL repeat-containing protein; NHL repeat-containing protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: endomembrane system; EXPRESSED IN: 22 plant structures; EXPRESSED DURING: 13 growth stages; CONTAINS InterPro DOMAIN/s: NHL repeat (InterPro:IPR001258), Six-bladed beta-propeller, TolB-like (InterPro:IPR011042); BEST Arabidopsis thaliana protein match is: NHL repeat-containing protein (TAIR:AT1G23880.1); Has 5848 Blast hits to 3428 proteins in 297 species: Archae - 62; Bacteria - 922; Metazoa - 1562; Fungi - 431; Plants - 140; Viruses - 2; Other Eukaryotes - 2729 (source: NCBI BLink).	447	1	QQQQQQKQHQKHQHQQQQQQQ	21	76.1904761904762	7	0.333333333333333	352	372	78	YAFMSKDAEKMQQLRQSRAFYSSWDAEFPN	HRRHYSSIPHTYYEQDSEKSNEIVFGAVQE	GO:0012505:endomembrane system;	GO:0008150:biological_process;	GO:0003674:molecular_function;	---
>prot|EG:AT1G30460.2-P|cod|AT1G30460.2-TAIR|gene|AT1G30460-TAIR-G|ann|CPSF30; RNA binding / calmodulin binding / endonuclease/ nucleic acid binding / protein binding; Encodes AtCPSF30, the 30-KDa subunit of cleavage and polyadenylation specificity factor. AtCPSF30 is a probable processing endonuclease. Nucleus-localized RNA binding protein capable of interacting with itself and with calmodulin. Its RNA-binding activity is inhibited by calmodulin in a calcium-dependent fashion.	250	1	QQQQQQQPQQSQHQ	14	78.5714285714286	7	0.5	199	212	79	YQARNVAPQLQDRPQGQVPMQGQPQESGNL	VSQTLIPNPADQTNRTSHPLPQGVNRCVQS	GO:0005634:nucleus;GO:0005847:mRNA cleavage and polyadenylation specificity factor complex;	GO:0006396:RNA processing;GO:0006397:mRNA processing;	GO:0003676:nucleic acid binding;GO:0003677:DNA binding;GO:0003723:RNA binding;GO:0004519:endonuclease activity;GO:0005515:protein binding;GO:0005516:calmodulin binding;GO:0008270:zinc ion binding;GO:0046872:metal ion binding;	---
>prot|EG:AT2G27210.1-P|cod|AT2G27210.1-TAIR|gene|AT2G27210-TAIR-G|ann|kelch repeat-containing serine/threonine phosphoesterase family protein; BRI1 SUPPRESSOR 1 (BSU1)-LIKE 3 (BSL3); FUNCTIONS IN: hydrolase activity, manganese ion binding, protein serine/threonine phosphatase activity, phosphoprotein phosphatase activity, iron ion binding; INVOLVED IN: biological_process unknown; LOCATED IN: cytosol, plasma membrane; EXPRESSED IN: guard cell, cultured cell; CONTAINS InterPro DOMAIN/s: Metallophosphoesterase (InterPro:IPR004843), Kelch repeat type 1 (InterPro:IPR006652), Galactose oxidase/kelch, beta-propeller (InterPro:IPR011043), Kelch repeat type 2 (InterPro:IPR011498), Serine/threonine protein phosphatase, BSU1 (InterPro:IPR012391), Kelch-type beta propeller (InterPro:IPR015915), Serine/threonine-specific protein phosphatase and bis(5-nucleosyl)-tetraphosphatase (InterPro:IPR006186); BEST Arabidopsis thaliana protein match is: kelch repeat-containing protein / serine/threonine phosphoesterase family protein (TAIR:AT1G08420.1); Has 8485 Blast hits to 6970 proteins in 411 species: Archae - 51; Bacteria - 250; Metazoa - 3427; Fungi - 1247; Plants - 1388; Viruses - 3; Other Eukaryotes - 2119 (source: NCBI BLink).	1006	1	QQQQQQQQQPQ	11	90.9090909090909	9	0.818181818181818	54	64	5	PMEEKEEASEQQTGSESESASLTPSLPPPS	VTAVVGPRCAPTYSVVNAIIEKKEDGPGPR	GO:0005634:nucleus;GO:0005829:cytosol;GO:0005886:plasma membrane;	GO:0008150:biological_process;	GO:0004721:phosphoprotein phosphatase activity;GO:0004722:protein serine/threonine phosphatase activity;GO:0005506:iron ion binding;GO:0016787:hydrolase activity;GO:0030145:manganese ion binding;GO:0046872:metal ion binding;	---
>prot|EG:AT5G18450.1-P|cod|AT5G18450.1-TAIR|gene|AT5G18450-TAIR-G|ann|AP2 domain-containing transcription factor, putative; encodes a member of the DREB subfamily A-2 of ERF/AP2 transcription factor family. The protein contains one AP2 domain. There are eight members in this subfamily including DREB2A AND DREB2B that are involved in response to drought.	307	1	QQQQQ	5	100	5	1	93	97	30	FNTSVEAAMAYDEAAKKLYGHEAKLNLVHP	VVVNRNLSFSGHGSGSWAYNKKLDMVHGLD	GO:0005634:nucleus;	GO:0006350:transcription;GO:0006355:regulation of transcription, DNA-dependent;GO:0045449:regulation of transcription;	GO:0003677:DNA binding;GO:0003700:sequence-specific DNA binding transcription factor activity;	---
>prot|EG:AT1G51520.2-P|cod|AT1G51520.2-TAIR|gene|AT1G51520-TAIR-G|ann|nucleic acid binding / nucleotide binding; nucleic acid binding / nucleotide binding; FUNCTIONS IN: nucleotide binding, nucleic acid binding; INVOLVED IN: biological_process unknown; LOCATED IN: cellular_component unknown; EXPRESSED IN: 9 plant structures; EXPRESSED DURING: 6 growth stages; CONTAINS InterPro DOMAIN/s: RNA recognition motif, RNP-1 (InterPro:IPR000504), Nucleotide-binding, alpha-beta plait (InterPro:IPR012677); BEST Arabidopsis thaliana protein match is: RNA binding / nucleic acid binding / nucleotide binding (TAIR:AT3G21100.2); Has 126 Blast hits to 90 proteins in 10 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 122; Viruses - 0; Other Eukaryotes - 4 (source: NCBI BLink).	513	1	QQQQQ	5	100	5	1	135	139	26	LNTLRDNKPNFNSSPFRESSSLFASSSGDE	FSNNFLFTNDEDPFANSHKRSFSANDACFE	GO:0005575:cellular_component;	GO:0006414:translational elongation;GO:0008150:biological_process;	GO:0000166:nucleotide binding;GO:0003676:nucleic acid binding;GO:0030533:triplet codon-amino acid adaptor activity;	---
>prot|EG:AT5G22910.1-P|cod|AT5G22910.1-TAIR|gene|AT5G22910-TAIR-G|ann|ATCHX9; monovalent cation:proton antiporter/ sodium:hydrogen antiporter; member of Putative Na+/H+ antiporter family	800	1	QQQQQ	5	100	5	1	794	798	99	AQWMELPELGVIGDLLASKDLRARVSVLVV	HG	GO:0016021:integral to membrane;	GO:0006810:transport;GO:0006812:cation transport;	GO:0005451:monovalent cation:hydrogen antiporter activity;GO:0015299:solute:hydrogen antiporter activity;GO:0015385:sodium:hydrogen antiporter activity;	---
>prot|EG:AT3G24870.1-P|cod|AT3G24870.1-TAIR|gene|AT3G24870-TAIR-G|ann|DNA binding; DNA binding; FUNCTIONS IN: DNA binding; LOCATED IN: apoplast; EXPRESSED IN: male gametophyte, cultured cell, pollen tube; EXPRESSED DURING: M germinated pollen stage; CONTAINS InterPro DOMAIN/s: HSA (InterPro:IPR006562), SANT, DNA-binding (InterPro:IPR001005), Homeodomain-like (InterPro:IPR009057), HAS subgroup (InterPro:IPR013999), Helicase/SANT-associated, DNA binding (InterPro:IPR014012), MYB-like (InterPro:IPR017877); BEST Arabidopsis thaliana protein match is: DNA binding (TAIR:AT3G24880.1); Has 12195 Blast hits to 8492 proteins in 384 species: Archae - 4; Bacteria - 324; Metazoa - 5744; Fungi - 1803; Plants - 1188; Viruses - 30; Other Eukaryotes - 3102 (source: NCBI BLink).	1922	1	QQQQQQ	6	100	6	1	1494	1499	77	HPHLQSPSQATGAQQEAFAIRQRQIHQRYL	FPASGSMMPHVQQPQGSSVSSSSQNSPQTQ	GO:0048046:apoplast;	---	GO:0003677:DNA binding;	---
>prot|EG:AT5G62090.2-P|cod|AT5G62090.2-TAIR|gene|AT5G62090-TAIR-G|ann|unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: cellular_component unknown; EXPRESSED IN: 17 plant structures; EXPRESSED DURING: 10 growth stages; BEST Arabidopsis thaliana protein match is: SLK1 (SEUSS-LIKE 1); transcription regulator (TAIR:AT4G25520.1); Has 38202 Blast hits to 15459 proteins in 742 species: Archae - 6; Bacteria - 1392; Metazoa - 14682; Fungi - 3752; Plants - 2341; Viruses - 407; Other Eukaryotes - 15622 (source: NCBI BLink).	816	2	QQQQQQQQQGQNPQFQ	16	75	9	0.5625	207	222	25	ARKKPRLDSKQDDALQQQILRQWLQRQDIL	ILLQQQKLRQQQQYLQSLPPLQRVQLQQQQ	GO:0005575:cellular_component;	GO:0008150:biological_process;	GO:0003674:molecular_function;	---
>prot|EG:AT5G62090.2-P|cod|AT5G62090.2-TAIR|gene|AT5G62090-TAIR-G|ann|unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: cellular_component unknown; EXPRESSED IN: 17 plant structures; EXPRESSED DURING: 10 growth stages; BEST Arabidopsis thaliana protein match is: SLK1 (SEUSS-LIKE 1); transcription regulator (TAIR:AT4G25520.1); Has 38202 Blast hits to 15459 proteins in 742 species: Archae - 6; Bacteria - 1392; Metazoa - 14682; Fungi - 3752; Plants - 2341; Viruses - 407; Other Eukaryotes - 15622 (source: NCBI BLink).	816	2	QLQQQQQVQQQQQLQQQHQQQQQQLQQQGMQMQ	33	75.7575757575758	6	0.181818181818182	247	279	30	QNPQFQILLQQQKLRQQQQYLQSLPPLQRV	LTGGPRPYENSVCARRLMQYLYHQRQRPSE	GO:0005575:cellular_component;	GO:0008150:biological_process;	GO:0003674:molecular_function;	---
>prot|EG:AT4G10970.5-P|cod|AT4G10970.5-TAIR|gene|AT4G10970-TAIR-G|ann|unknown protein; unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: cellular_component unknown; EXPRESSED IN: 24 plant structures; EXPRESSED DURING: 14 growth stages; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT4G23910.1).	212	1	QQQQQ	5	100	5	1	135	139	63	SIVGRLKWVDARFIAPPAQNRASQRGFVGK	REKIVQQQANGGGGGQRQWPQTLDSRFANM	GO:0005575:cellular_component;	GO:0008150:biological_process;	GO:0003674:molecular_function;	---
>prot|EG:AT4G18910.1-P|cod|AT4G18910.1-TAIR|gene|AT4G18910-TAIR-G|ann|NIP1;2 (NOD26-LIKE INTRINSIC PROTEIN 1;2); arsenite transmembrane transporter/ water channel; Encodes an aquaporin homolog. Functions in arsenite transport and tolerance.	294	1	QQQQQQ	6	100	6	1	26	31	8	MAEISGNGGDARDGAVVVNLKEEDEQQQQQ	AIHKPLKKQDSLLSISVPFLQKLMAEVLGT	GO:0005886:plasma membrane;GO:0016020:membrane;GO:0016021:integral to membrane;	GO:0006810:transport;GO:0015700:arsenite transport;GO:0046685:response to arsenic;	GO:0005215:transporter activity;GO:0015105:arsenite transmembrane transporter activity;GO:0015250:water channel activity;	---
>prot|EG:AT4G28140.1-P|cod|AT4G28140.1-TAIR|gene|AT4G28140-TAIR-G|ann|AP2 domain-containing transcription factor, putative; encodes a member of the DREB subfamily A-6 of ERF/AP2 transcription factor family. The protein contains one AP2 domain. There are 8 members in this subfamily including RAP2.4.	292	1	QQQQQQQQYMAQ	12	75	8	0.666666666666667	100	111	34	QQQLGSYVPVLEQRQDPTMQGQKQMISFSP	YWSDTLNLSPRGRMMMMMSQEAVQPYIATK	GO:0005634:nucleus;	GO:0006350:transcription;GO:0006355:regulation of transcription, DNA-dependent;GO:0009873:ethylene mediated signaling pathway;GO:0010200:response to chitin;GO:0045449:regulation of transcription;	GO:0003677:DNA binding;GO:0003700:sequence-specific DNA binding transcription factor activity;	---
>prot|EG:AT3G56650.1-P|cod|AT3G56650.1-TAIR|gene|AT3G56650-TAIR-G|ann|thylakoid lumenal 20 kDa protein; thylakoid lumenal 20 kDa protein; LOCATED IN: thylakoid, thylakoid lumen, chloroplast thylakoid lumen, chloroplast stroma, chloroplast; EXPRESSED IN: 21 plant structures; EXPRESSED DURING: 14 growth stages; CONTAINS InterPro DOMAIN/s: Mog1/PsbP/DUF1795, alpha/beta/alpha sandwich (InterPro:IPR016124), Mog1/PsbP, alpha/beta/alpha sandwich (InterPro:IPR016123); BEST Arabidopsis thaliana protein match is: thylakoid lumenal 29.8 kDa protein (TAIR:AT1G77090.1); Has 70 Blast hits to 70 proteins in 23 species: Archae - 0; Bacteria - 20; Metazoa - 0; Fungi - 0; Plants - 48; Viruses - 0; Other Eukaryotes - 2 (source: NCBI BLink).	262	1	QQQQQ	5	100	5	1	35	39	13	SLVPTSKIFSVSPKSSASIKARSRVVVASS	PRRRELLLKSAVAIPAILQLKEAPISAARE	GO:0009507:chloroplast;GO:0009536:plastid;GO:0009543:chloroplast thylakoid lumen;GO:0009570:chloroplast stroma;GO:0009579:thylakoid;GO:0031977:thylakoid lumen;	---	---	---
>prot|EG:AT4G01210.1-P|cod|AT4G01210.1-TAIR|gene|AT4G01210-TAIR-G|ann|transferase, transferring glycosyl groups; transferase, transferring glycosyl groups; FUNCTIONS IN: transferase activity, transferring glycosyl groups; INVOLVED IN: biosynthetic process; LOCATED IN: cellular_component unknown; EXPRESSED IN: 22 plant structures; EXPRESSED DURING: 13 growth stages; CONTAINS InterPro DOMAIN/s: Glycosyl transferase, group 1 (InterPro:IPR001296); BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT5G04480.1); Has 638 Blast hits to 636 proteins in 100 species: Archae - 6; Bacteria - 195; Metazoa - 0; Fungi - 0; Plants - 27; Viruses - 0; Other Eukaryotes - 410 (source: NCBI BLink).	1031	1	QQQQQQQQQQFFLQ	14	78.5714285714286	10	0.714285714285714	22	35	2	MGSLESGIPTKRDNGGVRGGRQQQQQQQQQ	RNRSRLSRFFLLKSFNYLLWISIICVFFFF	GO:0005575:cellular_component;	GO:0009058:biosynthetic process;	GO:0016757:transferase activity, transferring glycosyl groups;	---
>prot|EG:AT3G56580.3-P|cod|AT3G56580.3-TAIR|gene|AT3G56580-TAIR-G|ann|zinc finger (C3HC4-type RING finger) family protein; zinc finger (C3HC4-type RING finger) family protein; FUNCTIONS IN: protein binding, zinc ion binding; INVOLVED IN: biological_process unknown; LOCATED IN: cellular_component unknown; EXPRESSED IN: 18 plant structures; EXPRESSED DURING: 11 growth stages; CONTAINS InterPro DOMAIN/s: Zinc finger, RING-type (InterPro:IPR001841), Zinc finger, RING/FYVE/PHD-type (InterPro:IPR013083); BEST Arabidopsis thaliana protein match is: RHC1A; protein binding / zinc ion binding (TAIR:AT2G40830.3); Has 7019 Blast hits to 6954 proteins in 216 species: Archae - 0; Bacteria - 6; Metazoa - 2420; Fungi - 600; Plants - 2628; Viruses - 11; Other Eukaryotes - 1354 (source: NCBI BLink).	320	1	QQQQQQHQHQHQQQQ	15	80	6	0.4	294	308	91	PFRSSSSSSTQNRRDTNNTATAEEGHYHHH	SHMGYSGWPFDY	GO:0005575:cellular_component;	GO:0008150:biological_process;	GO:0005515:protein binding;GO:0008270:zinc ion binding;GO:0046872:metal ion binding;	---
>prot|EG:AT2G37420.1-P|cod|AT2G37420.1-TAIR|gene|AT2G37420-TAIR-G|ann|kinesin motor protein-related; kinesin motor protein-related; FUNCTIONS IN: microtubule motor activity, ATP binding; INVOLVED IN: microtubule-based movement; LOCATED IN: microtubule associated complex, chloroplast; EXPRESSED IN: 19 plant structures; EXPRESSED DURING: 9 growth stages; CONTAINS InterPro DOMAIN/s: Kinesin, motor region (InterPro:IPR001752); BEST Arabidopsis thaliana protein match is: kinesin motor protein-related (TAIR:AT3G45850.1); Has 34434 Blast hits to 24611 proteins in 1119 species: Archae - 264; Bacteria - 3176; Metazoa - 16741; Fungi - 2792; Plants - 1695; Viruses - 100; Other Eukaryotes - 9666 (source: NCBI BLink).	1039	1	QQQQQ	5	100	5	1	593	597	57	SDNQSMLLKFGSQLDQNLKDLHRTVLGSVS	LRTMEEHTHSFLAHKYDATRDLESRIGKTS	GO:0005874:microtubule;GO:0005875:microtubule associated complex;GO:0009507:chloroplast;	GO:0007018:microtubule-based movement;	GO:0000166:nucleotide binding;GO:0003774:motor activity;GO:0003777:microtubule motor activity;GO:0005524:ATP binding;	---
>prot|EG:AT2G36080.1-P|cod|AT2G36080.1-TAIR|gene|AT2G36080-TAIR-G|ann|DNA-binding protein, putative; Encodes a plant-specific B3 DNA-binding domain transcription factor. Has transcription repressor activity.	244	1	QQQQQQQQHQ	10	90	8	0.8	18	27	7	MSINQYSSDFHYHSLMWQQQQQQQQHQNDV	NDVVEEKEALFEKPLTPSDVGKLNRLVIPK	GO:0005575:cellular_component;GO:0005634:nucleus;	GO:0006350:transcription;GO:0006355:regulation of transcription, DNA-dependent;GO:0045449:regulation of transcription;	GO:0003677:DNA binding;GO:0003700:sequence-specific DNA binding transcription factor activity;GO:0016564:transcription repressor activity;	---
>prot|EG:AT5G10510.2-P|cod|AT5G10510.2-TAIR|gene|AT5G10510-TAIR-G|ann|AIL6 (AINTEGUMENTA-LIKE 6); DNA binding / transcription factor; Encodes an AP2-domain transcription factor involved in root stem cell identity and root development.	581	2	QQQQQQQQLQLQ	12	83.3333333333333	8	0.666666666666667	473	484	81	GAAKRLKLSLEAAASSEQKPILGHHQLHHF	SSPNHSSINFALCPNSAVQSQQIIPCGIPF	GO:0005634:nucleus;	GO:0006350:transcription;GO:0006355:regulation of transcription, DNA-dependent;GO:0009873:ethylene mediated signaling pathway;GO:0009887:organ morphogenesis;GO:0045449:regulation of transcription;GO:0048364:root development;	GO:0003677:DNA binding;GO:0003700:sequence-specific DNA binding transcription factor activity;	---
>prot|EG:AT5G10510.2-P|cod|AT5G10510.2-TAIR|gene|AT5G10510-TAIR-G|ann|AIL6 (AINTEGUMENTA-LIKE 6); DNA binding / transcription factor; Encodes an AP2-domain transcription factor involved in root stem cell identity and root development.	581	2	QQQQQHQQQQQQQNFFQ	17	76.4705882352941	7	0.411764705882353	524	540	90	FALCPNSAVQSQQIIPCGIPFEAAALYHHH	HFPANAASDSTGSNNNSNVQGTMGLMAPNP	GO:0005634:nucleus;	GO:0006350:transcription;GO:0006355:regulation of transcription, DNA-dependent;GO:0009873:ethylene mediated signaling pathway;GO:0009887:organ morphogenesis;GO:0045449:regulation of transcription;GO:0048364:root development;	GO:0003677:DNA binding;GO:0003700:sequence-specific DNA binding transcription factor activity;	---
>prot|EG:AT1G06070.1-P|cod|AT1G06070.1-TAIR|gene|AT1G06070-TAIR-G|ann|bZIP transcription factor, putative (bZIP69); bZIP transcription factor, putative (bZIP69); FUNCTIONS IN: transcription factor activity, DNA binding; INVOLVED IN: regulation of transcription, DNA-dependent; LOCATED IN: nucleus, chloroplast; EXPRESSED IN: 23 plant structures; EXPRESSED DURING: 13 growth stages; CONTAINS InterPro DOMAIN/s: Basic-leucine zipper (bZIP) transcription factor (InterPro:IPR004827), bZIP transcription factor, bZIP-1 (InterPro:IPR011616); BEST Arabidopsis thaliana protein match is: bZIP transcription factor (POSF21) (TAIR:AT2G31370.5); Has 38161 Blast hits to 16134 proteins in 672 species: Archae - 6; Bacteria - 1085; Metazoa - 14914; Fungi - 4009; Plants - 2167; Viruses - 428; Other Eukaryotes - 15552 (source: NCBI BLink).	423	1	QQQQQQQHQQQQQQQQQQFHFQQQQLYQLQQQQRLQQQEQQ	41	75.609756097561	10	0.24390243902439	352	392	83	SNQQFYPNNQSMHTILAAQQLQQLQIQSQK	SGASELRRPMPSPGQKESVTSPDRETPLTK	GO:0005634:nucleus;GO:0009507:chloroplast;	GO:0006355:regulation of transcription, DNA-dependent;	GO:0003677:DNA binding;GO:0003700:sequence-specific DNA binding transcription factor activity;GO:0043565:sequence-specific DNA binding;GO:0046983:protein dimerization activity;	---
>prot|EG:AT2G28540.2-P|cod|AT2G28540.2-TAIR|gene|AT2G28540-TAIR-G|ann|nucleic acid binding / nucleotide binding / protein binding / zinc ion binding; nucleic acid binding / nucleotide binding / protein binding / zinc ion binding; FUNCTIONS IN: protein binding, nucleotide binding, zinc ion binding, nucleic acid binding; EXPRESSED IN: 24 plant structures; EXPRESSED DURING: 15 growth stages; CONTAINS InterPro DOMAIN/s: RNA recognition motif, RNP-1 (InterPro:IPR000504), Zinc finger, RING-type (InterPro:IPR001841), Zinc finger, RING/FYVE/PHD-type (InterPro:IPR013083), Nucleotide-binding, alpha-beta plait (InterPro:IPR012677); BEST Arabidopsis thaliana protein match is: RNA recognition motif (RRM)-containing protein (TAIR:AT3G45630.1); Has 750 Blast hits to 532 proteins in 154 species: Archae - 0; Bacteria - 20; Metazoa - 236; Fungi - 103; Plants - 76; Viruses - 0; Other Eukaryotes - 315 (source: NCBI BLink).	960	1	QQQQQQ	6	100	6	1	868	873	90	AVGQGFENASLDFRSNFQGNTNMYGSAAKL	AVMQNPLSMQNPLSSHQNCRFTDSLGMAPR	---	---	GO:0000166:nucleotide binding;GO:0003676:nucleic acid binding;GO:0005515:protein binding;GO:0008270:zinc ion binding;	---
>prot|EG:AT1G28630.1-P|cod|AT1G28630.1-TAIR|gene|AT1G28630-TAIR-G|ann|unknown protein; unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT1G77960.1); Has 1247 Blast hits to 997 proteins in 121 species: Archae - 0; Bacteria - 18; Metazoa - 277; Fungi - 126; Plants - 104; Viruses - 0; Other Eukaryotes - 722 (source: NCBI BLink).	359	1	QQQQQ	5	100	5	1	117	121	32	SHGYLQQSDQQDLLNPNMLNCYQEPDVSTI	LNLPGPLEQSDLQRLLNPNMMYSEPDFSTS	GO:0012505:endomembrane system;	GO:0008150:biological_process;	GO:0003674:molecular_function;	---
>prot|EG:AT1G75340.1-P|cod|AT1G75340.1-TAIR|gene|AT1G75340-TAIR-G|ann|zinc finger (CCCH-type) family protein; zinc finger (CCCH-type) family protein; FUNCTIONS IN: zinc ion binding, nucleic acid binding; INVOLVED IN: biological_process unknown; LOCATED IN: mitochondrion; EXPRESSED IN: 22 plant structures; EXPRESSED DURING: 13 growth stages; CONTAINS InterPro DOMAIN/s: Zinc finger, CCCH-type (InterPro:IPR000571); BEST Arabidopsis thaliana protein match is: EMB2766 (EMBRYO DEFECTIVE 2766); structural constituent of nuclear pore (TAIR:AT2G45000.1); Has 6907 Blast hits to 2225 proteins in 238 species: Archae - 2; Bacteria - 178; Metazoa - 1711; Fungi - 786; Plants - 132; Viruses - 40; Other Eukaryotes - 4058 (source: NCBI BLink).	435	1	QNQQQQQQQQQQ	12	91.6666666666667	10	0.833333333333333	39	50	8	FQRGSCRYGENCRFLHPQQAKPNNPFGFGT	NSSNPFGFGVQSGGSSRPNQFQNTWSRTAS	GO:0005739:mitochondrion;	GO:0008150:biological_process;	GO:0003676:nucleic acid binding;GO:0003677:DNA binding;GO:0008270:zinc ion binding;GO:0046872:metal ion binding;	---
>prot|EG:AT1G25300.1-P|cod|AT1G25300.1-TAIR|gene|AT1G25300-TAIR-G|ann|octicosapeptide/Phox/Bem1p (PB1) domain-containing protein; octicosapeptide/Phox/Bem1p (PB1) domain-containing protein; INVOLVED IN: biological_process unknown; LOCATED IN: cellular_component unknown; CONTAINS InterPro DOMAIN/s: Octicosapeptide/Phox/Bem1p (InterPro:IPR000270); BEST Arabidopsis thaliana protein match is: octicosapeptide/Phox/Bem1p (PB1) domain-containing protein (TAIR:AT3G18230.1); Has 175 Blast hits to 175 proteins in 8 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 175; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink).	272	1	QQQQQ	5	100	5	1	221	225	81	ANDVGGFLDRETEIVEIQDQPRPILQEPLP	PLIICYLPVWQMRPHMVTYPVAAYALTPAT	GO:0005575:cellular_component;	GO:0008150:biological_process;	---	---
>prot|EG:AT2G03340.1-P|cod|AT2G03340.1-TAIR|gene|AT2G03340-TAIR-G|ann|WRKY3; transcription factor; Encodes WRKY DNA-binding protein 3 (WRKY3).	513	1	QQQQQQQQQ	9	100	9	1	191	199	37	QALAQVTAQAVQGNNVHMQQSQQSEYPSST	ASLTEIPSFSSAPRSQIRASVQETSQGQRE	GO:0005634:nucleus;	GO:0006350:transcription;GO:0006355:regulation of transcription, DNA-dependent;GO:0045449:regulation of transcription;	GO:0003677:DNA binding;GO:0003700:sequence-specific DNA binding transcription factor activity;GO:0043565:sequence-specific DNA binding;	---
>prot|EG:AT3G09290.1-P|cod|AT3G09290.1-TAIR|gene|AT3G09290-TAIR-G|ann|TAC1 (TELOMERASE ACTIVATOR1); nucleic acid binding / transcription factor/ zinc ion binding; encodes activation factor TAC1 which mediates telomerase activity	172	1	QQQQQ	5	100	5	1	93	97	54	KLRQKLMEDNKDDVVAESDASEVVSLDLNE	GEALTCDDHDQYVDNDISPKQKLEFWVQES	GO:0005622:intracellular;	GO:0045449:regulation of transcription;	GO:0003676:nucleic acid binding;GO:0003700:sequence-specific DNA binding transcription factor activity;GO:0008270:zinc ion binding;	---
>prot|EG:AT2G31070.1-P|cod|AT2G31070.1-TAIR|gene|AT2G31070-TAIR-G|ann|TCP10 (TCP DOMAIN PROTEIN 10); transcription factor; TCP family protein involved in heterchronic regulation of leaf differentiation.	361	1	QQQQQQ	6	100	6	1	275	280	76	MVNHHPHHHHHQPSMMTLLNSQQQQVFLGG	RGTLQSSLFPHSFRSWDHHQTTSDHHHHQN	GO:0005575:cellular_component;GO:0005634:nucleus;	GO:0006350:transcription;GO:0007275:multicellular organismal development;GO:0009965:leaf morphogenesis;GO:0030154:cell differentiation;GO:0045449:regulation of transcription;GO:0045962:positive regulation of development, heterochronic;GO:0048366:leaf development;	GO:0003677:DNA binding;GO:0003700:sequence-specific DNA binding transcription factor activity;	---
>prot|EG:AT2G46020.1-P|cod|AT2G46020.1-TAIR|gene|AT2G46020-TAIR-G|ann|transcription regulatory protein SNF2, putative; Encodes a SWI/SNF chromatin remodeling ATPase that upregulates transcription of all three CUC genes and is involved in the formation and/or maintenance of boundary cells during embryogenesis. Also mediates repression of expression of seed storage proteins in vegetative tissues. Interacts strongly with AtSWI3C, also with AtSWI3B, but not with AtSWI3A or AtSWI3D.	2192	2	QQQQQQQQQQQQQQQLASRQQQQQ	24	83.3333333333333	15	0.625	39	62	1	GPARNPAMGPAGRTASTSSAASPSSSSSSV	HRNSDTNENMFAYQPGGVQGMMGGGNFASS	GO:0005634:nucleus;GO:0005829:cytosol;GO:0016585:chromatin remodeling complex;	GO:0006350:transcription;GO:0007275:multicellular organismal development;GO:0010199:organ boundary specification between lateral organs and the meristem;GO:0016568:chromatin modification;GO:0040029:regulation of gene expression, epigenetic;GO:0043044:ATP-dependent chromatin remodeling;GO:0045449:regulation of transcription;	GO:0000166:nucleotide binding;GO:0003676:nucleic acid binding;GO:0003677:DNA binding;GO:0004386:helicase activity;GO:0005524:ATP binding;GO:0016787:hydrolase activity;GO:0016818:hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides;GO:0030528:transcription regulator activity;	---
>prot|EG:AT2G46020.1-P|cod|AT2G46020.1-TAIR|gene|AT2G46020-TAIR-G|ann|transcription regulatory protein SNF2, putative; Encodes a SWI/SNF chromatin remodeling ATPase that upregulates transcription of all three CUC genes and is involved in the formation and/or maintenance of boundary cells during embryogenesis. Also mediates repression of expression of seed storage proteins in vegetative tissues. Interacts strongly with AtSWI3C, also with AtSWI3B, but not with AtSWI3A or AtSWI3D.	2192	2	QQQQQQQQQ	9	100	9	1	110	118	5	VQGMMGGGNFASSPGSMQMPQQSRNFFESP	GSSTQEGQQNFNPMQQAYIQFAMQAQHQKA	GO:0005634:nucleus;GO:0005829:cytosol;GO:0016585:chromatin remodeling complex;	GO:0006350:transcription;GO:0007275:multicellular organismal development;GO:0010199:organ boundary specification between lateral organs and the meristem;GO:0016568:chromatin modification;GO:0040029:regulation of gene expression, epigenetic;GO:0043044:ATP-dependent chromatin remodeling;GO:0045449:regulation of transcription;	GO:0000166:nucleotide binding;GO:0003676:nucleic acid binding;GO:0003677:DNA binding;GO:0004386:helicase activity;GO:0005524:ATP binding;GO:0016787:hydrolase activity;GO:0016818:hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides;GO:0030528:transcription regulator activity;	---
>prot|EG:AT3G44920.1-P|cod|AT3G44920.1-TAIR|gene|AT3G44920-TAIR-G|ann|ATCHX11; monovalent cation:proton antiporter/ sodium:hydrogen antiporter; member of Putative Na+/H+ antiporter family	671	1	QQQQQQ	6	100	6	1	665	670	99	TEWVELPELGVIGDLLAARDLNSKVSVLVV	T	GO:0016021:integral to membrane;	GO:0006810:transport;GO:0006812:cation transport;	GO:0005451:monovalent cation:hydrogen antiporter activity;GO:0015299:solute:hydrogen antiporter activity;GO:0015385:sodium:hydrogen antiporter activity;	---
>prot|EG:AT1G24310.1-P|cod|AT1G24310.1-TAIR|gene|AT1G24310-TAIR-G|ann|unknown protein; unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: nucleolus; EXPRESSED IN: 20 plant structures; EXPRESSED DURING: 13 growth stages; Has 2665 Blast hits to 2221 proteins in 198 species: Archae - 0; Bacteria - 36; Metazoa - 1026; Fungi - 539; Plants - 312; Viruses - 11; Other Eukaryotes - 741 (source: NCBI BLink).	377	2	QQPQQQQQQQQQQQ	14	92.8571428571429	11	0.785714285714286	61	74	16	SATPAFGTPSNPSFSSGGFGSSLFSSPFSS	PSSLFQQQPSSNFGFQSPFNNTAQQQQQTP	GO:0005730:nucleolus;	GO:0008150:biological_process;	GO:0003674:molecular_function;	---
>prot|EG:AT1G24310.1-P|cod|AT1G24310.1-TAIR|gene|AT1G24310-TAIR-G|ann|unknown protein; unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: nucleolus; EXPRESSED IN: 20 plant structures; EXPRESSED DURING: 13 growth stages; Has 2665 Blast hits to 2221 proteins in 198 species: Archae - 0; Bacteria - 36; Metazoa - 1026; Fungi - 539; Plants - 312; Viruses - 11; Other Eukaryotes - 741 (source: NCBI BLink).	377	2	QQQQQ	5	100	5	1	98	102	25	QQQQQQQPSSLFQQQPSSNFGFQSPFNNTA	TPFPNAQLTTQMAPVAPIPYSLADRDVQAI	GO:0005730:nucleolus;	GO:0008150:biological_process;	GO:0003674:molecular_function;	---
>prot|EG:AT1G30460.1-P|cod|AT1G30460.1-TAIR|gene|AT1G30460-TAIR-G|ann|CPSF30; RNA binding / calmodulin binding / endonuclease/ nucleic acid binding / protein binding; Encodes AtCPSF30, the 30-KDa subunit of cleavage and polyadenylation specificity factor. AtCPSF30 is a probable processing endonuclease. Nucleus-localized RNA binding protein capable of interacting with itself and with calmodulin. Its RNA-binding activity is inhibited by calmodulin in a calcium-dependent fashion.	631	1	QQQQQQQPQQSQHQ	14	78.5714285714286	7	0.5	199	212	31	YQARNVAPQLQDRPQGQVPMQGQPQESGNL	VSQTLIPNPADQTNRTSHPLPQGVNRYFVV	GO:0005634:nucleus;GO:0005847:mRNA cleavage and polyadenylation specificity factor complex;	GO:0006396:RNA processing;GO:0006397:mRNA processing;	GO:0003676:nucleic acid binding;GO:0003677:DNA binding;GO:0003723:RNA binding;GO:0004519:endonuclease activity;GO:0005515:protein binding;GO:0005516:calmodulin binding;GO:0008270:zinc ion binding;GO:0046872:metal ion binding;	---
>prot|EG:AT3G13990.2-P|cod|AT3G13990.2-TAIR|gene|AT3G13990-TAIR-G|ann|unknown protein; unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: cytosol, nucleus; EXPRESSED IN: cultured cell; CONTAINS InterPro DOMAIN/s: Protein of unknown function DUF1296 (InterPro:IPR009719); BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT3G07660.1); Has 483 Blast hits to 417 proteins in 93 species: Archae - 0; Bacteria - 6; Metazoa - 202; Fungi - 61; Plants - 122; Viruses - 3; Other Eukaryotes - 89 (source: NCBI BLink).	847	1	QQQQQ	5	100	5	1	603	607	71	VRVQGLPSPHEQGLSAHMLNNAPPSTIPML	ASMQQMYPQVHVSHFPNLMPYRQFLSPVYV	GO:0005634:nucleus;GO:0005829:cytosol;	GO:0008150:biological_process;	GO:0003674:molecular_function;	---
>prot|EG:AT5G23260.3-P|cod|AT5G23260.3-TAIR|gene|AT5G23260-TAIR-G|ann|TT16 (TRANSPARENT TESTA16); transcription factor; Encodes a MADS box protein. Regulates proanthocyanidin biosynthesis in the inner-most cell layer of the seed coat. Also controls cell shape of the inner-most cell layer of the seed coat. Also shown to be necessary for determining the identity of the endothelial layer within the ovule.	238	1	QQQQQ	5	100	5	1	198	202	83	AGIDTKPGEYQQFIEQLQCYKPGEYQQFLE	PNSVLQLATLPSEIDPTYNLQLAQPNLQND	GO:0005634:nucleus;	GO:0006350:transcription;GO:0006355:regulation of transcription, DNA-dependent;GO:0008360:regulation of cell shape;GO:0009813:flavonoid biosynthetic process;GO:0045449:regulation of transcription;GO:0048316:seed development;GO:0048481:ovule development;	GO:0003677:DNA binding;GO:0003700:sequence-specific DNA binding transcription factor activity;GO:0005515:protein binding;GO:0043565:sequence-specific DNA binding;	---
>prot|EG:AT5G56270.1-P|cod|AT5G56270.1-TAIR|gene|AT5G56270-TAIR-G|ann|WRKY2; transcription factor; WRKY transcription factor 2	687	1	QVEQQQQQ	8	75	5	0.625	346	353	50	HITEIIYKGAHNHLKPPPNRRSGMQVDGTE	RDSAATWVSCNNTQQQGGSNENNVEEGSTR	GO:0005634:nucleus;	GO:0006350:transcription;GO:0006355:regulation of transcription, DNA-dependent;GO:0045449:regulation of transcription;	GO:0003677:DNA binding;GO:0003700:sequence-specific DNA binding transcription factor activity;GO:0043565:sequence-specific DNA binding;	---
>prot|EG:AT1G21700.1-P|cod|AT1G21700.1-TAIR|gene|AT1G21700-TAIR-G|ann|ATSWI3C (SWITCH/SUCROSE NONFERMENTING 3C); DNA binding; a member of the Arabidopsis SWI3 gene family. Protein physically interacts with ATSWI3B and ATSWI3A, the other two members of the SWI3 family. Homologous to yeast SWI3 & RSC8, components of the SWI/SNF and RSC chromatin remodeling complexes. Referred to as CHB3 in Zhou et al (2003).	807	1	QQQQQQQQQQQQQQ	14	100	14	1	726	739	89	QQASATSQPSIIPGFSNNPQVQAQMHFMAR	AFSFGPRLPLNAIQTNAGSTASPNVMFGNN	GO:0005634:nucleus;GO:0016514:SWI/SNF complex;GO:0016585:chromatin remodeling complex;	GO:0006338:chromatin remodeling;GO:0006350:transcription;GO:0007275:multicellular organismal development;GO:0016568:chromatin modification;GO:0045449:regulation of transcription;	GO:0003677:DNA binding;GO:0005515:protein binding;	---
>prot|EG:AT4G25520.1-P|cod|AT4G25520.1-TAIR|gene|AT4G25520-TAIR-G|ann|SLK1 (SEUSS-LIKE 1); transcription regulator; SEUSS-LIKE 1 (SLK1); FUNCTIONS IN: transcription regulator activity; EXPRESSED IN: 22 plant structures; EXPRESSED DURING: 13 growth stages; BEST Arabidopsis thaliana protein match is: SLK3 (SEUSS-LIKE 3); transcription regulator (TAIR:AT4G25515.1); Has 16774 Blast hits to 7715 proteins in 383 species: Archae - 0; Bacteria - 502; Metazoa - 5522; Fungi - 1321; Plants - 618; Viruses - 192; Other Eukaryotes - 8619 (source: NCBI BLink).	748	2	QQQQQQ	6	100	6	1	71	76	9	TSPMSFSSNSVNIPGSLVLDGSAASMQHLP	LLQQQTGQGSVPMRENNYSHVDKKPRLEVK	---	---	GO:0030528:transcription regulator activity;	---
>prot|EG:AT4G25520.1-P|cod|AT4G25520.1-TAIR|gene|AT4G25520-TAIR-G|ann|SLK1 (SEUSS-LIKE 1); transcription regulator; SEUSS-LIKE 1 (SLK1); FUNCTIONS IN: transcription regulator activity; EXPRESSED IN: 22 plant structures; EXPRESSED DURING: 13 growth stages; BEST Arabidopsis thaliana protein match is: SLK3 (SEUSS-LIKE 3); transcription regulator (TAIR:AT4G25515.1); Has 16774 Blast hits to 7715 proteins in 383 species: Archae - 0; Bacteria - 502; Metazoa - 5522; Fungi - 1321; Plants - 618; Viruses - 192; Other Eukaryotes - 8619 (source: NCBI BLink).	748	2	QLQQQQQ	7	85.7142857142857	5	0.714285714285714	158	164	21	RNPQMQALLQQQRLRQHQQMLQSMSPSQRL	LRQQLQQQGTQQIPPNVRPYEVGVCARKLM	---	---	GO:0030528:transcription regulator activity;	---
>prot|EG:AT2G40220.1-P|cod|AT2G40220.1-TAIR|gene|AT2G40220-TAIR-G|ann|ABI4 (ABA INSENSITIVE 4); DNA binding / transcription factor; encodes a member of the DREB subfamily A-3 of ERF/AP2 transcription factor family (ABI4). The protein contains one AP2 domain. There is only one member in this family. Involved in abscisic acid (ABA) signal transduction, ABA-mediated glucose response, and hexokinase-dependent sugar responses. Expressed most abundantly in developing siliques and to a lesser degree in seedlings.	328	1	QQQQQQNQ	8	87.5	6	0.75	188	195	57	NFGPYGIPFNNNIFLNGGTSMLCPSYGFFP	MVQMGQFQHQQYQNLHSNTNNNKISDIELT	GO:0005634:nucleus;	GO:0005983:starch catabolic process;GO:0006350:transcription;GO:0006355:regulation of transcription, DNA-dependent;GO:0006950:response to stress;GO:0006952:defense response;GO:0006970:response to osmotic stress;GO:0009414:response to water deprivation;GO:0009737:response to abscisic acid stimulus;GO:0009738:abscisic acid mediated signaling pathway;GO:0009744:response to sucrose stimulus;GO:0009747:hexokinase-dependent signaling;GO:0009749:response to glucose stimulus;GO:0009873:ethylene mediated signaling pathway;GO:0010182:sugar mediated signaling pathway;GO:0010353:response to trehalose stimulus;GO:0019433:triglyceride catabolic process;GO:0031930:mitochondria-nucleus signaling pathway;GO:0045449:regulation of transcription;GO:0048316:seed development;	GO:0003677:DNA binding;GO:0003700:sequence-specific DNA binding transcription factor activity;GO:0010843:promoter binding;GO:0016563:transcription activator activity;	---
>prot|EG:AT3G03760.1-P|cod|AT3G03760.1-TAIR|gene|AT3G03760-TAIR-G|ann|LBD20 (LOB DOMAIN-CONTAINING PROTEIN 20); LBD20 (LOB DOMAIN-CONTAINING PROTEIN 20); CONTAINS InterPro DOMAIN/s: Lateral organ boundaries, LOB (InterPro:IPR004883), Uncharacterised conserved protein UCP038127, LOB (InterPro:IPR017394); BEST Arabidopsis thaliana protein match is: JLO (JAGGED LATERAL ORGANS) (TAIR:AT4G00220.1); Has 528 Blast hits to 525 proteins in 21 species: Archae - 0; Bacteria - 0; Metazoa - 17; Fungi - 0; Plants - 511; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink).	273	1	QQQTHHQQQQQQ	12	75	6	0.5	164	175	60	LQQQVASLQAELSVVQSQLINSRVAMANVM	LVVMQQPEYSNNSSASTTLAGAAMNSFTMT	GO:0005743:mitochondrial inner membrane;	GO:0006810:transport;	GO:0005488:binding;	---
>prot|EG:AT5G60100.1-P|cod|AT5G60100.1-TAIR|gene|AT5G60100-TAIR-G|ann|APRR3 (ARABIDOPSIS PSEUDO-RESPONSE REGULATOR 3); transcription regulator/ two-component response regulator; Encodes pseudo-response regulator 3 (APRR3/PRR3). PRR3 transcript levels vary in a circadian pattern with peak expression at dusk under long and short day conditions. PRR3 affects the period of the circadian clock and seedlings with reduced levels of PRR3 have shorter periods, based on transcriptional assays of clock-regulated genes. PRR3 is expressed in the vasculature of cotyledons and leaves where it may help stabilize the TOC1 protein by preventing interactions between TOC1 and the F-box protein ZTL.	495	1	QISQQQQQ	8	75	5	0.625	40	47	8	DEVETERQVFGSSEEDEFRVEDTARNTNNV	PLAHVVKWERYLPVRSLKVLLVENDDSTRH	GO:0005634:nucleus;	GO:0000160:two-component signal transduction system (phosphorelay);GO:0006350:transcription;GO:0006355:regulation of transcription, DNA-dependent;GO:0007623:circadian rhythm;GO:0032091:negative regulation of protein binding;GO:0042752:regulation of circadian rhythm;GO:0045449:regulation of transcription;	GO:0000156:two-component response regulator activity;GO:0005515:protein binding;GO:0030528:transcription regulator activity;	---
>prot|EG:AT1G16710.1-P|cod|AT1G16710.1-TAIR|gene|AT1G16710-TAIR-G|ann|HAC12 (histone acetyltransferase of the CBP family 12); H3/H4 histone acetyltransferase/ histone acetyltransferase/ transcription cofactor; Encodes an enzyme with histone acetyltransferase activity that can use both H3 and H4 histones as substrates. No single prior lysine acetylation is sufficient to block HAC12 acetylation of the H3 or H4 peptides, suggesting that HAC12 can acetylate any of several lysines present in the peptides.	1706	2	QSQQQQQRQ	9	77.7777777777778	5	0.555555555555556	267	275	15	TAQMIPTPGFVNSVTNNNSGGFSAEPTIVP	HTGGQNSHMLSNHMAAGVRPDMQSKPSGAA	GO:0005634:nucleus;	GO:0006350:transcription;GO:0006355:regulation of transcription, DNA-dependent;GO:0006473:protein amino acid acetylation;GO:0009908:flower development;GO:0016568:chromatin modification;GO:0045449:regulation of transcription;	GO:0003712:transcription cofactor activity;GO:0003713:transcription coactivator activity;GO:0004402:histone acetyltransferase activity;GO:0005515:protein binding;GO:0008270:zinc ion binding;GO:0008415:acyltransferase activity;GO:0016740:transferase activity;GO:0046872:metal ion binding;	---
>prot|EG:AT1G16710.1-P|cod|AT1G16710.1-TAIR|gene|AT1G16710-TAIR-G|ann|HAC12 (histone acetyltransferase of the CBP family 12); H3/H4 histone acetyltransferase/ histone acetyltransferase/ transcription cofactor; Encodes an enzyme with histone acetyltransferase activity that can use both H3 and H4 histones as substrates. No single prior lysine acetylation is sufficient to block HAC12 acetylation of the H3 or H4 peptides, suggesting that HAC12 can acetylate any of several lysines present in the peptides.	1706	2	QQQPNQIQQQQQQ	13	76.9230769230769	6	0.461538461538462	418	430	24	NINTASFQPVSRVNSSLSHQQQFQQPPNRF	FLNQRKLKQQTPQQHRLISNDGLGKTQVDS	GO:0005634:nucleus;	GO:0006350:transcription;GO:0006355:regulation of transcription, DNA-dependent;GO:0006473:protein amino acid acetylation;GO:0009908:flower development;GO:0016568:chromatin modification;GO:0045449:regulation of transcription;	GO:0003712:transcription cofactor activity;GO:0003713:transcription coactivator activity;GO:0004402:histone acetyltransferase activity;GO:0005515:protein binding;GO:0008270:zinc ion binding;GO:0008415:acyltransferase activity;GO:0016740:transferase activity;GO:0046872:metal ion binding;	---
>prot|EG:AT1G07970.1-P|cod|AT1G07970.1-TAIR|gene|AT1G07970-TAIR-G|ann|unknown protein; unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; EXPRESSED IN: 22 plant structures; EXPRESSED DURING: 13 growth stages; Has 164 Blast hits to 163 proteins in 58 species: Archae - 0; Bacteria - 2; Metazoa - 113; Fungi - 15; Plants - 20; Viruses - 0; Other Eukaryotes - 14 (source: NCBI BLink).	693	1	QQFQQQQQQQQQQ	13	92.3076923076923	10	0.769230769230769	462	474	66	SLDEDALLHQLRANLVQAIDASMQKLRTEN	AALIPVMQECVDAISEHRRLQGLMKGEWVK	GO:0016020:membrane;	GO:0008150:biological_process;	GO:0003674:molecular_function;GO:0005509:calcium ion binding;	---
>prot|EG:AT3G14010.3-P|cod|AT3G14010.3-TAIR|gene|AT3G14010-TAIR-G|ann|CID4 (CTC-Interacting Domain 4); protein binding; hydroxyproline-rich glycoprotein family protein, similar to Mrs16p (GI:2737884) (Saccharomyces cerevisiae); weak similarity to ataxin-2 related protein (GI:1679686) (Homo sapiens). Included in a family of CTC interacting domain proteins found to interact with PAB2.	595	1	QQQQQ	5	100	5	1	560	564	94	GNQPQMMYHPQAYYHPNGQPQYPQQQMIPG	MIPGQQHPRPVYYMHPPPYPQDMPYHNKGR	---	---	GO:0005515:protein binding;	---
>prot|EG:AT1G25540.2-P|cod|AT1G25540.2-TAIR|gene|AT1G25540-TAIR-G|ann|PFT1 (PHYTOCHROME AND FLOWERING TIME 1); transcription coactivator; Encodes a nuclear protein that acts in a phyB pathway (but downstream of phyB) and induces flowering in response to suboptimal light conditions. Mutants are hypo-responsive to far-red and hyper-responsive to red light and flower late under long day conditions.	727	4	QIPNQQQQQQQQLHQQQQQQQQIQQQQQQQQ	31	80.6451612903226	8	0.258064516129032	568	598	78	PSQTLLLSVSDKACRLIGMLFPGDMVVFKP	HLQQQQMPQLQQQQQQHQQQQQQQHQLSQL	GO:0005634:nucleus;GO:0009428:bacterial-type flagellum basal body, distal rod, P ring;GO:0030288:outer membrane-bounded periplasmic space;	GO:0001539:ciliary or flagellar motility;GO:0009585:red, far-red light phototransduction;GO:0010114:response to red light;GO:0010218:response to far red light;GO:0045941:positive regulation of transcription;	GO:0003713:transcription coactivator activity;GO:0005198:structural molecule activity;	---
>prot|EG:AT1G25540.2-P|cod|AT1G25540.2-TAIR|gene|AT1G25540-TAIR-G|ann|PFT1 (PHYTOCHROME AND FLOWERING TIME 1); transcription coactivator; Encodes a nuclear protein that acts in a phyB pathway (but downstream of phyB) and induces flowering in response to suboptimal light conditions. Mutants are hypo-responsive to far-red and hyper-responsive to red light and flower late under long day conditions.	727	4	QIPNQQQQQQQQLHQQQQQQQQIQQQQQQQQHLQQQQMPQLQQQQQQHQQQQQQQHQ	57	77.1929824561403	8	0.140350877192982	568	624	78	PSQTLLLSVSDKACRLIGMLFPGDMVVFKP	LSQLQHHQQQQQQQQQQQQQHQLTQLQHHH	GO:0005634:nucleus;GO:0009428:bacterial-type flagellum basal body, distal rod, P ring;GO:0030288:outer membrane-bounded periplasmic space;	GO:0001539:ciliary or flagellar motility;GO:0009585:red, far-red light phototransduction;GO:0010114:response to red light;GO:0010218:response to far red light;GO:0045941:positive regulation of transcription;	GO:0003713:transcription coactivator activity;GO:0005198:structural molecule activity;	---
>prot|EG:AT1G25540.2-P|cod|AT1G25540.2-TAIR|gene|AT1G25540-TAIR-G|ann|PFT1 (PHYTOCHROME AND FLOWERING TIME 1); transcription coactivator; Encodes a nuclear protein that acts in a phyB pathway (but downstream of phyB) and induces flowering in response to suboptimal light conditions. Mutants are hypo-responsive to far-red and hyper-responsive to red light and flower late under long day conditions.	727	4	QQQQQ	5	100	5	1	655	659	90	LSQLQHHQQQQQQQQQQQQQHQLTQLQHHH	ASPLNQMQQQTSPLNQMQQQTSPLNQMQQQ	GO:0005634:nucleus;GO:0009428:bacterial-type flagellum basal body, distal rod, P ring;GO:0030288:outer membrane-bounded periplasmic space;	GO:0001539:ciliary or flagellar motility;GO:0009585:red, far-red light phototransduction;GO:0010114:response to red light;GO:0010218:response to far red light;GO:0045941:positive regulation of transcription;	GO:0003713:transcription coactivator activity;GO:0005198:structural molecule activity;	---
>prot|EG:AT1G25540.2-P|cod|AT1G25540.2-TAIR|gene|AT1G25540-TAIR-G|ann|PFT1 (PHYTOCHROME AND FLOWERING TIME 1); transcription coactivator; Encodes a nuclear protein that acts in a phyB pathway (but downstream of phyB) and induces flowering in response to suboptimal light conditions. Mutants are hypo-responsive to far-red and hyper-responsive to red light and flower late under long day conditions.	727	4	QMQQQQQPQQ	10	80	5	0.5	685	694	94	QQQQQASPLNQMQQQTSPLNQMQQQTSPLN	MVMGGQAFAQAPGRSQQGGGGGQPNMPGAG	GO:0005634:nucleus;GO:0009428:bacterial-type flagellum basal body, distal rod, P ring;GO:0030288:outer membrane-bounded periplasmic space;	GO:0001539:ciliary or flagellar motility;GO:0009585:red, far-red light phototransduction;GO:0010114:response to red light;GO:0010218:response to far red light;GO:0045941:positive regulation of transcription;	GO:0003713:transcription coactivator activity;GO:0005198:structural molecule activity;	---
>prot|EG:AT3G14750.1-P|cod|AT3G14750.1-TAIR|gene|AT3G14750-TAIR-G|ann|unknown protein; unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; EXPRESSED IN: 16 plant structures; EXPRESSED DURING: 9 growth stages; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT1G67170.1); Has 3322 Blast hits to 2437 proteins in 324 species: Archae - 47; Bacteria - 376; Metazoa - 1403; Fungi - 181; Plants - 273; Viruses - 4; Other Eukaryotes - 1038 (source: NCBI BLink).	331	1	QQQQQQQ	7	100	7	1	316	322	95	YTMNPAQTGVVGYYPPPYGPQAAWAGGYDP	PPPQGQGHR	---	GO:0008150:biological_process;	GO:0003674:molecular_function;	---
>prot|EG:AT1G48410.2-P|cod|AT1G48410.2-TAIR|gene|AT1G48410-TAIR-G|ann|AGO1 (ARGONAUTE 1); endoribonuclease/ miRNA binding / protein binding / siRNA binding; Encodes an RNA Slicer that selectively recruits microRNAs and siRNAs. There is currently no evidence that AGO1 Slicer is in a high molecular weight RNA-induced silencing complex (RISC). Mutants are defective in post-transcriptional gene silencing and have pleiotropic developmental and morphological defects. Through its action on the regulation of ARF17 expression, the protein regulates genes involved at the cross talk between auxin and light signaling during adventitious root development. AGO1 seems to be targeted for degradation by silencing suppressor F-box-containing proteins from Turnip yellow virus and Cucurbit aphid-borne yellow virus.	1050	1	QPPQQQQQ	8	75	5	0.625	66	73	6	GFQQGGGQHQGGRGYTPQPQQGGRGGRGYG	YGGPQEYQGRGRGGPPHQGGRGGYGGGRGG	GO:0005634:nucleus;GO:0005737:cytoplasm;GO:0005829:cytosol;	GO:0007275:multicellular organismal development;GO:0009616:virus induced gene silencing;GO:0009733:response to auxin stimulus;GO:0009793:embryo development ending in seed dormancy;GO:0009850:auxin metabolic process;GO:0009965:leaf morphogenesis;GO:0010218:response to far red light;GO:0016246:RNA interference;GO:0016441:posttranscriptional gene silencing;GO:0035195:gene silencing by miRNA;GO:0048830:adventitious root development;GO:0048864:stem cell development;	GO:0003676:nucleic acid binding;GO:0004521:endoribonuclease activity;GO:0005515:protein binding;GO:0035197:siRNA binding;GO:0035198:miRNA binding;	---
>prot|EG:AT1G04570.1-P|cod|AT1G04570.1-TAIR|gene|AT1G04570-TAIR-G|ann|integral membrane transporter family protein; integral membrane transporter family protein; FUNCTIONS IN: transporter activity; INVOLVED IN: transport; LOCATED IN: chloroplast, membrane; CONTAINS InterPro DOMAIN/s: Biopterin transport-related protein BT1 (InterPro:IPR004324), Major facilitator superfamily, general substrate transporter (InterPro:IPR016196); BEST Arabidopsis thaliana protein match is: integral membrane transporter family protein (TAIR:AT2G33280.1); Has 457 Blast hits to 455 proteins in 149 species: Archae - 6; Bacteria - 186; Metazoa - 0; Fungi - 8; Plants - 126; Viruses - 0; Other Eukaryotes - 131 (source: NCBI BLink).	542	1	QQQQQERQ	8	75	5	0.625	30	37	5	MERIMINPLLSIQNSPTKFLKPPLSSIHRQ	SNNNTLFMGEARPRRATTFACLSIRRRRNN	GO:0009507:chloroplast;GO:0016020:membrane;	GO:0006810:transport;	GO:0005215:transporter activity;	---
>prot|EG:AT5G63470.2-P|cod|AT5G63470.2-TAIR|gene|AT5G63470-TAIR-G|ann|NF-YC4 (NUCLEAR FACTOR Y, SUBUNIT C4); DNA binding / transcription factor; NUCLEAR FACTOR Y, SUBUNIT C4 (NF-YC4); FUNCTIONS IN: transcription factor activity, DNA binding; INVOLVED IN: regulation of transcription, DNA-dependent; LOCATED IN: nucleus; EXPRESSED IN: male gametophyte, pollen tube; EXPRESSED DURING: L mature pollen stage, M germinated pollen stage; CONTAINS InterPro DOMAIN/s: Transcription factor CBF/NF-Y/archaeal histone (InterPro:IPR003958), Histone-fold (InterPro:IPR009072); BEST Arabidopsis thaliana protein match is: NF-YC1 (NUCLEAR FACTOR Y, SUBUNIT C1); DNA binding / transcription activator/ transcription factor (TAIR:AT3G48590.1); Has 950 Blast hits to 950 proteins in 161 species: Archae - 0; Bacteria - 0; Metazoa - 376; Fungi - 232; Plants - 264; Viruses - 0; Other Eukaryotes - 78 (source: NCBI BLink).	250	1	QQQQQQLQ	8	87.5	6	0.75	51	58	20	GSAVTTVIPPPPSGSASIVTGGGATYHHLL	MFWTYQRQEIEQVNDFKNHQLPLARIKKIM	GO:0005576:extracellular region;GO:0005622:intracellular;GO:0005634:nucleus;	GO:0006350:transcription;GO:0006355:regulation of transcription, DNA-dependent;GO:0045449:regulation of transcription;	GO:0003677:DNA binding;GO:0003700:sequence-specific DNA binding transcription factor activity;GO:0043565:sequence-specific DNA binding;	---
>prot|EG:AT1G31150.1-P|cod|AT1G31150.1-TAIR|gene|AT1G31150-TAIR-G|ann|transcription factor; transcription factor; FUNCTIONS IN: transcription factor activity; INVOLVED IN: regulation of transcription, DNA-dependent; LOCATED IN: nucleus; EXPRESSED IN: 19 plant structures; EXPRESSED DURING: 6 growth stages; CONTAINS InterPro DOMAIN/s: Region of unknown function DUF1985 (InterPro:IPR015410), Transcription factor, K-box (InterPro:IPR002487); BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT1G36970.1); Has 238 Blast hits to 231 proteins in 35 species: Archae - 0; Bacteria - 1; Metazoa - 6; Fungi - 4; Plants - 217; Viruses - 0; Other Eukaryotes - 10 (source: NCBI BLink).	673	1	QEQQQQQ	7	85.7142857142857	5	0.714285714285714	623	629	92	GHGLNNLTYDELLHFEHQLESSLHIARAHK	TDKLKENLMVCQRHEDDDIMHRQVKKENPP	GO:0005634:nucleus;	GO:0006355:regulation of transcription, DNA-dependent;	GO:0003700:sequence-specific DNA binding transcription factor activity;	---
>prot|EG:AT5G18550.1-P|cod|AT5G18550.1-TAIR|gene|AT5G18550-TAIR-G|ann|nucleic acid binding / zinc ion binding; nucleic acid binding / zinc ion binding; FUNCTIONS IN: zinc ion binding, nucleic acid binding; INVOLVED IN: biological_process unknown; LOCATED IN: cellular_component unknown; EXPRESSED IN: 17 plant structures; EXPRESSED DURING: 8 growth stages; CONTAINS InterPro DOMAIN/s: Zinc finger, CCCH-type (InterPro:IPR000571); BEST Arabidopsis thaliana protein match is: nucleic acid binding / zinc ion binding (TAIR:AT3G06410.1); Has 2403 Blast hits to 980 proteins in 158 species: Archae - 0; Bacteria - 30; Metazoa - 563; Fungi - 234; Plants - 615; Viruses - 0; Other Eukaryotes - 961 (source: NCBI BLink).	465	1	QQQQQQ	6	100	6	1	181	186	38	CSYFMRTGQCKFGSTCRYHHPVPPGVQAPS	LSAGPTMYPSLQSQTVPSSQQYGVVLARPQ	GO:0005575:cellular_component;GO:0005634:nucleus;	GO:0008150:biological_process;	GO:0003676:nucleic acid binding;GO:0003677:DNA binding;GO:0003723:RNA binding;GO:0008270:zinc ion binding;GO:0046872:metal ion binding;	---
>prot|EG:AT2G31370.4-P|cod|AT2G31370.4-TAIR|gene|AT2G31370-TAIR-G|ann|bZIP transcription factor (POSF21); bZIP transcription factor (POSF21); FUNCTIONS IN: transcription factor activity, DNA binding; INVOLVED IN: regulation of transcription, DNA-dependent; LOCATED IN: nucleus; EXPRESSED IN: 22 plant structures; EXPRESSED DURING: 13 growth stages; CONTAINS InterPro DOMAIN/s: Basic-leucine zipper (bZIP) transcription factor (InterPro:IPR004827), Basic leucine zipper (InterPro:IPR011700); BEST Arabidopsis thaliana protein match is: bZIP transcription factor, putative (bZIP69) (TAIR:AT1G06070.1); Has 54269 Blast hits to 19856 proteins in 831 species: Archae - 14; Bacteria - 2070; Metazoa - 21047; Fungi - 5854; Plants - 2899; Viruses - 481; Other Eukaryotes - 21904 (source: NCBI BLink).	398	1	QKQQQQQQQQQQQHQQQQQQQQQYQFQQQQMQQLMQQRLQQQEQQ	45	77.7777777777778	11	0.244444444444444	340	384	85	GSNQQQFYSNNQSMQTILAAKQFQQLQIHS	NGVRLKPSQAQKEN	GO:0005634:nucleus;	GO:0006350:transcription;GO:0006355:regulation of transcription, DNA-dependent;GO:0045449:regulation of transcription;	GO:0003677:DNA binding;GO:0003700:sequence-specific DNA binding transcription factor activity;GO:0043565:sequence-specific DNA binding;GO:0046983:protein dimerization activity;	---
>prot|EG:AT1G46264.1-P|cod|AT1G46264.1-TAIR|gene|AT1G46264-TAIR-G|ann|AT-HSFB4; DNA binding / transcription factor; member of Heat Stress Transcription Factor (Hsf) family	348	1	QKQQQQQ	7	85.7142857142857	5	0.714285714285714	249	255	71	KLYNDIIYFVQNHVKPVAPSNNSSYLSSFL	PPTLDYYNTATVNATNLNALNSSPPTSQSS	GO:0005634:nucleus;GO:0005737:cytoplasm;	GO:0006350:transcription;GO:0006355:regulation of transcription, DNA-dependent;GO:0006950:response to stress;GO:0045449:regulation of transcription;	GO:0003677:DNA binding;GO:0003700:sequence-specific DNA binding transcription factor activity;GO:0043565:sequence-specific DNA binding;	---
>prot|EG:AT5G20730.3-P|cod|AT5G20730.3-TAIR|gene|AT5G20730-TAIR-G|ann|NPH4 (NON-PHOTOTROPHIC HYPOCOTYL); DNA binding / transcription activator/ transcription factor/ transcription regulator; Encodes an auxin-regulated transcriptional activator. Activates expression of IAA1 and IAA9 in the presence of auxin. Mutants affect blue light and gravitropic and auxin mediated growth responses. Together with AUX19, it is involved in the response to ethylene. In the arf7 arf19 double mutant, several auxin-responsive genes (e.g. IAA5, LBD16, LBD29 and LBD33) are no longer upregulated by auxin.	1150	2	QQQQSQSQQQQQQQQLLQQQQQLQSQQ	27	77.7777777777778	8	0.296296296296296	517	543	44	QAPMSQLPQPPTTLSQQQQLQQLLHSSLNH	HSNNNQSQSQQQQQLLQQQQQQQLQQQHQQ	GO:0005634:nucleus;GO:0005737:cytoplasm;	GO:0006350:transcription;GO:0006355:regulation of transcription, DNA-dependent;GO:0007275:multicellular organismal development;GO:0009630:gravitropism;GO:0009638:phototropism;GO:0009723:response to ethylene stimulus;GO:0009725:response to hormone stimulus;GO:0009733:response to auxin stimulus;GO:0009734:auxin mediated signaling pathway;GO:0009785:blue light signaling pathway;GO:0010386:lateral root primordium development;GO:0031424:keratinization;GO:0040008:regulation of growth;GO:0045449:regulation of transcription;GO:0048366:leaf development;GO:0048527:lateral root development;	GO:0003677:DNA binding;GO:0003700:sequence-specific DNA binding transcription factor activity;GO:0005515:protein binding;GO:0016563:transcription activator activity;GO:0030528:transcription regulator activity;GO:0046983:protein dimerization activity;	---
>prot|EG:AT5G20730.3-P|cod|AT5G20730.3-TAIR|gene|AT5G20730-TAIR-G|ann|NPH4 (NON-PHOTOTROPHIC HYPOCOTYL); DNA binding / transcription activator/ transcription factor/ transcription regulator; Encodes an auxin-regulated transcriptional activator. Activates expression of IAA1 and IAA9 in the presence of auxin. Mutants affect blue light and gravitropic and auxin mediated growth responses. Together with AUX19, it is involved in the response to ethylene. In the arf7 arf19 double mutant, several auxin-responsive genes (e.g. IAA5, LBD16, LBD29 and LBD33) are no longer upregulated by auxin.	1150	2	QQQQQQQ	7	100	7	1	759	765	66	QKAHQAQAQQIFQQSLLEQPHIQFQLLQRL	FLSPQSQLPHHQLQSQQLQQLPTLSQGHQF	GO:0005634:nucleus;GO:0005737:cytoplasm;	GO:0006350:transcription;GO:0006355:regulation of transcription, DNA-dependent;GO:0007275:multicellular organismal development;GO:0009630:gravitropism;GO:0009638:phototropism;GO:0009723:response to ethylene stimulus;GO:0009725:response to hormone stimulus;GO:0009733:response to auxin stimulus;GO:0009734:auxin mediated signaling pathway;GO:0009785:blue light signaling pathway;GO:0010386:lateral root primordium development;GO:0031424:keratinization;GO:0040008:regulation of growth;GO:0045449:regulation of transcription;GO:0048366:leaf development;GO:0048527:lateral root development;	GO:0003677:DNA binding;GO:0003700:sequence-specific DNA binding transcription factor activity;GO:0005515:protein binding;GO:0016563:transcription activator activity;GO:0030528:transcription regulator activity;GO:0046983:protein dimerization activity;	---
>prot|EG:AT4G36650.1-P|cod|AT4G36650.1-TAIR|gene|AT4G36650-TAIR-G|ann|ATPBRP (PLANT-SPECIFIC TFIIB-RELATED PROTEIN); RNA polymerase II transcription factor/ rDNA binding; Encodes a protein with similarity to the general transcription factor TFIIB. pBRP binds rDNA sequences in vitro. pBRP has been localized to the outer face of the plastid membrane with GFP fusion however, under conditions of proteosome inhibition it is found in the nucleus.	503	1	QQQQQ	5	100	5	1	423	427	84	GTASVMNPAEMISEPAKPNAMDYEKQQLDK	LGDKETLPIYLRDHNPFPSNPSPSTGISTI	GO:0005634:nucleus;GO:0005667:transcription factor complex;GO:0009527:plastid outer membrane;	GO:0006352:transcription initiation;GO:0006355:regulation of transcription, DNA-dependent;GO:0006413:translational initiation;	GO:0000182:rDNA binding;GO:0003702:RNA polymerase II transcription factor activity;GO:0003743:translation initiation factor activity;GO:0005515:protein binding;GO:0008270:zinc ion binding;GO:0030528:transcription regulator activity;	---
>prot|EG:AT1G49760.1-P|cod|AT1G49760.1-TAIR|gene|AT1G49760-TAIR-G|ann|PAB8 (POLY(A) BINDING PROTEIN 8); RNA binding / translation initiation factor; polyadenylate-binding protein, putative / PABP, putative, similar to poly(A)-binding protein GB:AAF66825 GI:7673359 from (Nicotiana tabacum). Highly and ubiquitously expressed. Member of the class II PABP family.	671	1	QQGQQQQQQQQQQQ	14	92.8571428571429	11	0.785714285714286	487	500	72	PQPGFGYQQQLVPGMRPGGSPMPNFFMPMM	RPGGGRRGALPQPQQPSPMMQQQMHPRGRM	---	GO:0042309:homoiothermy;GO:0046686:response to cadmium ion;GO:0050826:response to freezing;	GO:0000166:nucleotide binding;GO:0003676:nucleic acid binding;GO:0003723:RNA binding;GO:0003743:translation initiation factor activity;GO:0050825:ice binding;	---
>prot|EG:AT4G02560.1-P|cod|AT4G02560.1-TAIR|gene|AT4G02560-TAIR-G|ann|LD (luminidependens); transcription factor; Encodes a nuclear localized protein with similarity to transcriptional regulators. Recessive mutants are late flowering. Expression of LFY is reduced in LD mutants.	953	1	QQQQQQ	6	100	6	1	843	848	88	SAYSNSITLAHTEREQQQYMQPKLHHNLHF	PISTTSYAVREPVGQMGTGTSSSWRSQQSQ	GO:0005634:nucleus;	GO:0006350:transcription;GO:0006355:regulation of transcription, DNA-dependent;GO:0007275:multicellular organismal development;GO:0009908:flower development;GO:0009911:positive regulation of flower development;GO:0030154:cell differentiation;GO:0045449:regulation of transcription;	GO:0003677:DNA binding;GO:0003700:sequence-specific DNA binding transcription factor activity;GO:0005515:protein binding;GO:0043565:sequence-specific DNA binding;	---
>prot|EG:AT4G25940.1-P|cod|AT4G25940.1-TAIR|gene|AT4G25940-TAIR-G|ann|epsin N-terminal homology (ENTH) domain-containing protein; epsin N-terminal homology (ENTH) domain-containing protein; FUNCTIONS IN: phospholipid binding, clathrin binding, binding, phosphatidylinositol binding; INVOLVED IN: clathrin coat assembly; LOCATED IN: clathrin coat; EXPRESSED IN: 14 plant structures; EXPRESSED DURING: 10 growth stages; CONTAINS InterPro DOMAIN/s: Epsin-like, N-terminal (InterPro:IPR013809), ANTH (InterPro:IPR011417), ENTH/VHS (InterPro:IPR008942), Clathrin adaptor, phosphoinositide-binding, GAT-like (InterPro:IPR014712); BEST Arabidopsis thaliana protein match is: epsin N-terminal homology (ENTH) domain-containing protein / clathrin assembly protein-related (TAIR:AT5G57200.1); Has 11104 Blast hits to 4070 proteins in 260 species: Archae - 25; Bacteria - 212; Metazoa - 6916; Fungi - 563; Plants - 384; Viruses - 323; Other Eukaryotes - 2681 (source: NCBI BLink).	601	1	QQQQQQQ	7	100	7	1	533	539	88	AAPPNPFQMQQDPFAMSNNIAPPTNVQMAM	MTMMHQSPYNYTHPHDYHQNHHHHQFSAGP	GO:0005794:Golgi apparatus;GO:0005905:coated pit;GO:0016020:membrane;GO:0030118:clathrin coat;GO:0030136:clathrin-coated vesicle;GO:0031410:cytoplasmic vesicle;	GO:0006897:endocytosis;GO:0008152:metabolic process;GO:0048268:clathrin coat assembly;	GO:0003824:catalytic activity;GO:0005488:binding;GO:0005524:ATP binding;GO:0005543:phospholipid binding;GO:0005545:phosphatidylinositol binding;GO:0030276:clathrin binding;	---
>prot|EG:AT1G17380.1-P|cod|AT1G17380.1-TAIR|gene|AT1G17380-TAIR-G|ann|JAZ5 (JASMONATE-ZIM-DOMAIN PROTEIN 5); JASMONATE-ZIM-DOMAIN PROTEIN 5 (JAZ5); FUNCTIONS IN: molecular_function unknown; INVOLVED IN: response to jasmonic acid stimulus; LOCATED IN: cellular_component unknown; EXPRESSED IN: 20 plant structures; EXPRESSED DURING: 12 growth stages; CONTAINS InterPro DOMAIN/s: Tify (InterPro:IPR010399), CCT domain-like (InterPro:IPR018467); BEST Arabidopsis thaliana protein match is: JAZ6 (JASMONATE-ZIM-DOMAIN PROTEIN 6) (TAIR:AT1G72450.1); Has 172 Blast hits to 167 proteins in 18 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 172; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink).	274	1	QQQQQEQNQ	9	77.7777777777778	5	0.555555555555556	169	177	61	PINDENNNNKSSMVLPDLNEPTDNNHLTKE	IVERIARRASLHRFFAKRKDRAVARAPYQV	GO:0005575:cellular_component;GO:0005634:nucleus;	GO:0006350:transcription;GO:0006952:defense response;GO:0009753:response to jasmonic acid stimulus;GO:0045449:regulation of transcription;	GO:0003674:molecular_function;GO:0005515:protein binding;	---
>prot|EG:AT5G55020.1-P|cod|AT5G55020.1-TAIR|gene|AT5G55020-TAIR-G|ann|MYB120 (MYB DOMAIN PROTEIN 120); DNA binding / transcription factor; Encodes a putative transcription factor, member of the R2R3 factor gene family (MYB120).	523	2	QQQQQ	5	100	5	1	154	158	29	TRLKRLLRQGLPLYPPDIIPNHQLHPHPHH	HNHHHHHHQQQQQHQQMYFQPQSSQRNTPS	GO:0005634:nucleus;	GO:0045449:regulation of transcription;	GO:0003677:DNA binding;GO:0003700:sequence-specific DNA binding transcription factor activity;	---
>prot|EG:AT5G55020.1-P|cod|AT5G55020.1-TAIR|gene|AT5G55020-TAIR-G|ann|MYB120 (MYB DOMAIN PROTEIN 120); DNA binding / transcription factor; Encodes a putative transcription factor, member of the R2R3 factor gene family (MYB120).	523	2	QQQQQHQQ	8	87.5	5	0.625	167	174	31	YPPDIIPNHQLHPHPHHQQQQQHNHHHHHH	MYFQPQSSQRNTPSSSPLPSPTPANAKSSS	GO:0005634:nucleus;	GO:0045449:regulation of transcription;	GO:0003677:DNA binding;GO:0003700:sequence-specific DNA binding transcription factor activity;	---
>prot|EG:AT3G24880.1-P|cod|AT3G24880.1-TAIR|gene|AT3G24880-TAIR-G|ann|DNA binding; DNA binding; FUNCTIONS IN: DNA binding; EXPRESSED IN: cultured cell; CONTAINS InterPro DOMAIN/s: HSA (InterPro:IPR006562), SANT, DNA-binding (InterPro:IPR001005), Homeodomain-like (InterPro:IPR009057), HAS subgroup (InterPro:IPR013999), Helicase/SANT-associated, DNA binding (InterPro:IPR014012), MYB-like (InterPro:IPR017877); BEST Arabidopsis thaliana protein match is: DNA binding (TAIR:AT3G24870.1); Has 15740 Blast hits to 10745 proteins in 438 species: Archae - 4; Bacteria - 401; Metazoa - 7721; Fungi - 2365; Plants - 1543; Viruses - 52; Other Eukaryotes - 3654 (source: NCBI BLink).	1957	1	QQQQQQQQ	8	100	8	1	1527	1534	78	HPHLQSPSQATGAQQEAFAIRQRQIHQRYL	FPASGSMMPHVQQPQGSSVSSSPQNSPQTQ	---	---	GO:0003677:DNA binding;	---
>prot|EG:AT1G04150.1-P|cod|AT1G04150.1-TAIR|gene|AT1G04150-TAIR-G|ann|C2 domain-containing protein; C2 domain-containing protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: cellular_component unknown; EXPRESSED IN: 24 plant structures; EXPRESSED DURING: 14 growth stages; CONTAINS InterPro DOMAIN/s: C2 membrane targeting protein (InterPro:IPR018029), C2 calcium/lipid-binding region, CaLB (InterPro:IPR008973), Phosphoribosyltransferase C-terminal, plant (InterPro:IPR013583), C2 calcium-dependent membrane targeting (InterPro:IPR000008); BEST Arabidopsis thaliana protein match is: C2 domain-containing protein (TAIR:AT5G12970.1); Has 2701 Blast hits to 2265 proteins in 163 species: Archae - 0; Bacteria - 2; Metazoa - 1863; Fungi - 64; Plants - 546; Viruses - 2; Other Eukaryotes - 224 (source: NCBI BLink).	1012	1	QQQQQQQQQQ	10	100	10	1	171	180	16	ENGENVRRVNRSGGSKKSKKVQNVSSSMAI	ISLHNHNRGNQQQSQQNGQGQRMLPFYPHQ	GO:0005575:cellular_component;	GO:0008150:biological_process;	GO:0003674:molecular_function;	---
>prot|EG:AT2G43190.1-P|cod|AT2G43190.1-TAIR|gene|AT2G43190-TAIR-G|ann|ribonuclease P family protein; ribonuclease P family protein; FUNCTIONS IN: ribonuclease activity, ribonuclease P activity, RNA binding; INVOLVED IN: tRNA processing, mRNA cleavage, rRNA processing; LOCATED IN: ribonuclease P complex, nucleolar ribonuclease P complex, ribonuclease MRP complex; EXPRESSED IN: 23 plant structures; EXPRESSED DURING: 14 growth stages; CONTAINS InterPro DOMAIN/s: Ribonuclease P/MRP, p29 subunit, eukaryotic/archaeal (InterPro:IPR002730), Ribonuclease P/MRP, p29 subunit, eukaryotic (InterPro:IPR016848); Has 223 Blast hits to 223 proteins in 113 species: Archae - 0; Bacteria - 0; Metazoa - 106; Fungi - 69; Plants - 16; Viruses - 0; Other Eukaryotes - 32 (source: NCBI BLink).	296	1	QLLQQQQQ	8	75	5	0.625	28	35	9	MGTETVVHDQARWAMAAMERRLAVAKAQLL	KNEKDKKGTSDVDVSMKESHQADSLPTPSK	GO:0000172:ribonuclease MRP complex;GO:0005655:nucleolar ribonuclease P complex;GO:0030677:ribonuclease P complex;	GO:0006364:rRNA processing;GO:0006379:mRNA cleavage;GO:0008033:tRNA processing;	GO:0003723:RNA binding;GO:0004526:ribonuclease P activity;GO:0004540:ribonuclease activity;	---
>prot|EG:AT4G10970.6-P|cod|AT4G10970.6-TAIR|gene|AT4G10970-TAIR-G|ann|unknown protein; unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: cellular_component unknown; EXPRESSED IN: 24 plant structures; EXPRESSED DURING: 14 growth stages; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT4G23910.1).	281	1	QQQQQ	5	100	5	1	204	208	72	YFLCTEGIRIMKFIAPPAQNRASQRGFVGK	REKIVQQQANGGGGGQRQWPQTLDSRFANM	GO:0005575:cellular_component;	GO:0008150:biological_process;	GO:0003674:molecular_function;	---
>prot|EG:AT1G75730.1-P|cod|AT1G75730.1-TAIR|gene|AT1G75730-TAIR-G|ann|unknown protein; unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; EXPRESSED IN: 21 plant structures; EXPRESSED DURING: 12 growth stages; Has 251 Blast hits to 223 proteins in 67 species: Archae - 0; Bacteria - 74; Metazoa - 64; Fungi - 10; Plants - 5; Viruses - 0; Other Eukaryotes - 98 (source: NCBI BLink).	589	1	QQQQQQLQ	8	87.5	6	0.75	479	486	81	SQLSPATSSHQVQQLSPYLASRFQTAYNAN	KRLWAAQYRPTNGNTMQSNQYSKPNLSLNL	---	GO:0008150:biological_process;	GO:0003674:molecular_function;	---
>prot|EG:AT4G10970.4-P|cod|AT4G10970.4-TAIR|gene|AT4G10970-TAIR-G|ann|unknown protein; unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: cellular_component unknown; EXPRESSED IN: 24 plant structures; EXPRESSED DURING: 14 growth stages; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT4G23910.1).	217	1	QQQQQ	5	100	5	1	140	144	64	NGGRMTNTNQSRFIAPPAQNRASQRGFVGK	REKIVQQQANGGGGGQRQWPQTLDSRFANM	GO:0005575:cellular_component;	GO:0008150:biological_process;	GO:0003674:molecular_function;	---
>prot|EG:AT3G44910.1-P|cod|AT3G44910.1-TAIR|gene|AT3G44910-TAIR-G|ann|ATCHX12; monovalent cation:proton antiporter/ sodium:hydrogen antiporter; member of Putative Na+/H+ antiporter family	705	1	QQQQQ	5	100	5	1	700	704	99	MEWVELPELGVIGDLLASRELDSRVSVLVV	T	GO:0016021:integral to membrane;	GO:0006810:transport;GO:0006812:cation transport;	GO:0005451:monovalent cation:hydrogen antiporter activity;GO:0015299:solute:hydrogen antiporter activity;GO:0015385:sodium:hydrogen antiporter activity;	---
>prot|EG:AT1G01160.1-P|cod|AT1G01160.1-TAIR|gene|AT1G01160-TAIR-G|ann|SSXT protein-related / transcription co-activator-related; Arabidopsis thaliana GRF1-interacting factor 2 (GIF2) mRNA	195	1	QQQQQ	5	100	5	1	135	139	69	FMQHPQASPAGIFAPRGPLQFGSPLQFQDP	IHQQAMQGHMGIRPMGMTNNGMQHAMQQPE	GO:0005634:nucleus;	GO:0008150:biological_process;	GO:0003713:transcription coactivator activity;GO:0005515:protein binding;	---
>prot|EG:AT4G37730.1-P|cod|AT4G37730.1-TAIR|gene|AT4G37730-TAIR-G|ann|AtbZIP7 (Arabidopsis thaliana basic leucine-zipper 7); DNA binding / transcription factor; Arabidopsis thaliana basic leucine-zipper 7 (AtbZIP7); FUNCTIONS IN: transcription factor activity, DNA binding; INVOLVED IN: regulation of transcription, DNA-dependent; LOCATED IN: nucleus; EXPRESSED IN: 19 plant structures; EXPRESSED DURING: 7 growth stages; CONTAINS InterPro DOMAIN/s: Basic-leucine zipper (bZIP) transcription factor (InterPro:IPR004827), bZIP transcription factor, bZIP-1 (InterPro:IPR011616); BEST Arabidopsis thaliana protein match is: AtbZIP6 (Arabidopsis thaliana basic leucine-zipper 6); DNA binding / transcription factor (TAIR:AT2G22850.1); Has 1154 Blast hits to 1152 proteins in 104 species: Archae - 0; Bacteria - 2; Metazoa - 50; Fungi - 14; Plants - 1060; Viruses - 0; Other Eukaryotes - 28 (source: NCBI BLink).	305	1	QLQQQQQ	7	85.7142857142857	5	0.714285714285714	280	286	91	RVNSDNNRLVTEQEILRLRLSEMRRILIIR	WELHNRRMIMTEQNHPHLQ	GO:0005634:nucleus;	GO:0006355:regulation of transcription, DNA-dependent;	GO:0003677:DNA binding;GO:0003700:sequence-specific DNA binding transcription factor activity;GO:0043565:sequence-specific DNA binding;GO:0046983:protein dimerization activity;	---
>prot|EG:AT3G04590.2-P|cod|AT3G04590.2-TAIR|gene|AT3G04590-TAIR-G|ann|DNA-binding family protein; DNA-binding family protein; FUNCTIONS IN: DNA binding; INVOLVED IN: biological_process unknown; LOCATED IN: cellular_component unknown; EXPRESSED IN: 22 plant structures; EXPRESSED DURING: 13 growth stages; CONTAINS InterPro DOMAIN/s: Protein of unknown function DUF296 (InterPro:IPR005175), AT hook, DNA-binding, conserved site (InterPro:IPR017956); BEST Arabidopsis thaliana protein match is: DNA-binding protein-related (TAIR:AT5G28590.1); Has 2965 Blast hits to 2644 proteins in 187 species: Archae - 0; Bacteria - 45; Metazoa - 1692; Fungi - 274; Plants - 459; Viruses - 15; Other Eukaryotes - 480 (source: NCBI BLink).	411	1	QQQQQQQQQQ	10	100	10	1	20	29	4	MDPNESHHHHQQQQLHHLHQQQQQQQQQQR	RLTSPYFHHQLQHHHHLPTTVATTASTGNA	GO:0005575:cellular_component;	GO:0008150:biological_process;GO:0009405:pathogenesis;	GO:0003677:DNA binding;	---
>prot|EG:AT1G48270.1-P|cod|AT1G48270.1-TAIR|gene|AT1G48270-TAIR-G|ann|GCR1 (G-PROTEIN-COUPLED RECEPTOR 1); G-protein coupled receptor; encodes a protein similar to G-coupled receptor with 7 transmembrane regions. Overexpression studies suggest this gene is involved in dormancy and flowering. Reduction of expression results in decreased sensitivity to cytokinin.	326	1	QQQQQ	5	100	5	1	309	313	94	IHERLELFLPERLYRWLPSNFRPKNHLILH	RSEMVSLKTEDQQ	GO:0005575:cellular_component;GO:0005886:plasma membrane;GO:0016020:membrane;GO:0016021:integral to membrane;	GO:0000278:mitotic cell cycle;GO:0006571:tyrosine biosynthetic process;GO:0007166:cell surface receptor linked signaling pathway;GO:0007186:G-protein coupled receptor protein signaling pathway;GO:0008150:biological_process;GO:0009094:L-phenylalanine biosynthetic process;GO:0009735:response to cytokinin stimulus;GO:0009908:flower development;GO:0010231:maintenance of seed dormancy;GO:0010244:response to low fluence blue light stimulus by blue low-fluence system;	GO:0003674:molecular_function;GO:0004872:receptor activity;GO:0004888:transmembrane receptor activity;GO:0004930:G-protein coupled receptor activity;GO:0005515:protein binding;GO:0030552:cAMP binding;	---
>prot|EG:AT2G26450.1-P|cod|AT2G26450.1-TAIR|gene|AT2G26450-TAIR-G|ann|pectinesterase family protein; pectinesterase family protein; FUNCTIONS IN: enzyme inhibitor activity, pectinesterase activity; INVOLVED IN: cell wall modification; LOCATED IN: cell wall, plant-type cell wall; EXPRESSED IN: 9 plant structures; EXPRESSED DURING: L mature pollen stage, M germinated pollen stage, 4 anthesis, C globular stage, petal differentiation and expansion stage; CONTAINS InterPro DOMAIN/s: Pectinesterase, active site (InterPro:IPR018040), Pectin lyase fold/virulence factor (InterPro:IPR011050), Pectinesterase, catalytic (InterPro:IPR000070), Pectinesterase inhibitor (InterPro:IPR006501), Pectin lyase fold (InterPro:IPR012334); BEST Arabidopsis thaliana protein match is: pectinesterase family protein (TAIR:AT4G33230.1); Has 1480 Blast hits to 1433 proteins in 226 species: Archae - 0; Bacteria - 312; Metazoa - 5; Fungi - 138; Plants - 1022; Viruses - 0; Other Eukaryotes - 3 (source: NCBI BLink).	614	1	QQQQQQQ	7	100	7	1	55	61	8	IIVGTVSLLVVVAAIVGGAFAYVAYEKRNE	AKNHNKSGSGNNVVKDSDKKSPSPPTPSQK	GO:0005618:cell wall;GO:0009505:plant-type cell wall;GO:0016020:membrane;GO:0016021:integral to membrane;	GO:0042545:cell wall modification;	GO:0004857:enzyme inhibitor activity;GO:0016787:hydrolase activity;GO:0030599:pectinesterase activity;GO:0045330:aspartyl esterase activity;	---
>prot|EG:AT5G11060.1-P|cod|AT5G11060.1-TAIR|gene|AT5G11060-TAIR-G|ann|KNAT4 (KNOTTED1-LIKE HOMEOBOX GENE 4); transcription activator/ transcription factor; A member of Class II KN1-like homeodomain transcription factors (together with KNAT3 and KNAT5), with greatest homology to the maize knox1 homeobox protein. Expression regulated by light. Detected in all tissues examined, but most prominent in leaves and young siliques. Transient expression of GFP translational fusion protein suggests bipartite localization in nucleus and cytoplasm. KNAT4 promoter activity showed cell-type specific pattern along longitudinal root axis; GUS expression pattern started at the elongation zone, predominantly in the phloem and pericycle cells, extending to endodermis toward the base of the root.	393	1	QQQQQQHFQ	9	77.7777777777778	6	0.666666666666667	24	32	6	MAFHNNHFNHFTDQQQHQPPPPPQQQQQQH	ESAPPNWLLRSDNNFLNLHTAASAAATSSD	GO:0005634:nucleus;GO:0005737:cytoplasm;GO:0005829:cytosol;	GO:0006355:regulation of transcription, DNA-dependent;GO:0009416:response to light stimulus;GO:0045449:regulation of transcription;	GO:0003677:DNA binding;GO:0003700:sequence-specific DNA binding transcription factor activity;GO:0016563:transcription activator activity;GO:0030528:transcription regulator activity;GO:0043565:sequence-specific DNA binding;	---
>prot|EG:AT3G44930.1-P|cod|AT3G44930.1-TAIR|gene|AT3G44930-TAIR-G|ann|ATCHX10 (CATION/H+ EXCHANGER 10); monovalent cation:proton antiporter/ sodium:hydrogen antiporter; member of Putative Na+/H+ antiporter family	783	1	QQQQQ	5	100	5	1	777	781	99	MEWVELPELGVIGDLLAARDLSSKVSVLVV	RT	GO:0016021:integral to membrane;	GO:0006810:transport;GO:0006812:cation transport;	GO:0005451:monovalent cation:hydrogen antiporter activity;GO:0015299:solute:hydrogen antiporter activity;GO:0015385:sodium:hydrogen antiporter activity;	---
>prot|EG:AT4G00660.2-P|cod|AT4G00660.2-TAIR|gene|AT4G00660-TAIR-G|ann|DEAD/DEAH box helicase, putative; DEAD/DEAH box helicase, putative; FUNCTIONS IN: helicase activity, nucleic acid binding, ATP-dependent helicase activity, ATP binding; EXPRESSED IN: 24 plant structures; EXPRESSED DURING: 15 growth stages; CONTAINS InterPro DOMAIN/s: RNA helicase, DEAD-box type, Q motif (InterPro:IPR014014), DNA/RNA helicase, DEAD/DEAH box type, N-terminal (InterPro:IPR011545), RNA helicase, ATP-dependent, DEAD-box, conserved site (InterPro:IPR000629), DEAD-like helicase, N-terminal (InterPro:IPR014001), DNA/RNA helicase, C-terminal (InterPro:IPR001650), Helicase, superfamily 1 and 2, ATP-binding (InterPro:IPR014021); BEST Arabidopsis thaliana protein match is: DEAD/DEAH box helicase, putative (RH12) (TAIR:AT3G61240.2); Has 29911 Blast hits to 28926 proteins in 1767 species: Archae - 415; Bacteria - 11594; Metazoa - 5504; Fungi - 3568; Plants - 1459; Viruses - 51; Other Eukaryotes - 7320 (source: NCBI BLink).	505	1	QPHQYQQQQQQQQQ	14	78.5714285714286	9	0.642857142857143	58	71	11	SGYQQHPPPQYVQRGNYAQNHQQQFQQAPS	WLRRGQIPGGNSNGDAVVEVEKTVQSEVID	GO:0000932:cytoplasmic mRNA processing body;GO:0005737:cytoplasm;	GO:0006397:mRNA processing;GO:0006417:regulation of translation;GO:0006810:transport;GO:0051028:mRNA transport;	GO:0000166:nucleotide binding;GO:0003676:nucleic acid binding;GO:0003723:RNA binding;GO:0004386:helicase activity;GO:0005524:ATP binding;GO:0008026:ATP-dependent helicase activity;GO:0016787:hydrolase activity;	---
>prot|EG:AT2G02070.1-P|cod|AT2G02070.1-TAIR|gene|AT2G02070-TAIR-G|ann|AtIDD5 (Arabidopsis thaliana Indeterminate(ID)-Domain 5); nucleic acid binding / transcription factor/ zinc ion binding; Arabidopsis thaliana Indeterminate(ID)-Domain 5 (AtIDD5); FUNCTIONS IN: transcription factor activity, zinc ion binding, nucleic acid binding; INVOLVED IN: regulation of transcription; LOCATED IN: intracellular, chloroplast; EXPRESSED IN: 22 plant structures; EXPRESSED DURING: 13 growth stages; CONTAINS InterPro DOMAIN/s: Zinc finger, C2H2-like (InterPro:IPR015880), Zinc finger, C2H2-type (InterPro:IPR007087); BEST Arabidopsis thaliana protein match is: AtIDD4 (Arabidopsis thaliana Indeterminate(ID)-Domain 4); transcription factor (TAIR:AT2G02080.1); Has 53167 Blast hits to 22405 proteins in 446 species: Archae - 6; Bacteria - 320; Metazoa - 45323; Fungi - 921; Plants - 495; Viruses - 6; Other Eukaryotes - 6096 (source: NCBI BLink).	602	1	QQQQQQQQQQQQQQQ	15	100	15	1	546	560	90	KGLSADKQSMTRDFLGVGQIVKSMSGSGGF	HGNSRERVGSSSDSADRSSMNVNTGGGPAS	GO:0005622:intracellular;GO:0009507:chloroplast;	GO:0045449:regulation of transcription;	GO:0003676:nucleic acid binding;GO:0003700:sequence-specific DNA binding transcription factor activity;GO:0008270:zinc ion binding;	---
>prot|EG:AT1G62300.1-P|cod|AT1G62300.1-TAIR|gene|AT1G62300-TAIR-G|ann|WRKY6; transcription factor; transcription factor WRKY6 (WRKY6)	553	2	QQQQQQ	6	100	6	1	197	202	35	MTMDNQKLRELLTQVSNSYTSLQMHLVSLM	NNKVIEAAEKPEETIVPRQFIDLGPTRAVG	GO:0005634:nucleus;	GO:0006350:transcription;GO:0006355:regulation of transcription, DNA-dependent;GO:0009873:ethylene mediated signaling pathway;GO:0010200:response to chitin;GO:0045449:regulation of transcription;	GO:0003677:DNA binding;GO:0003700:sequence-specific DNA binding transcription factor activity;GO:0043565:sequence-specific DNA binding;	---
>prot|EG:AT1G62300.1-P|cod|AT1G62300.1-TAIR|gene|AT1G62300-TAIR-G|ann|WRKY6; transcription factor; transcription factor WRKY6 (WRKY6)	553	2	QRPQQQQQQ	9	77.7777777777778	6	0.666666666666667	461	469	83	TLDLTHSPPPPNGSNPSSSAATNNNHNSLM	MTNLPPGMLPHVIGQALYNQSKFSGLQFSG	GO:0005634:nucleus;	GO:0006350:transcription;GO:0006355:regulation of transcription, DNA-dependent;GO:0009873:ethylene mediated signaling pathway;GO:0010200:response to chitin;GO:0045449:regulation of transcription;	GO:0003677:DNA binding;GO:0003700:sequence-specific DNA binding transcription factor activity;GO:0043565:sequence-specific DNA binding;	---
>prot|EG:AT1G49720.1-P|cod|AT1G49720.1-TAIR|gene|AT1G49720-TAIR-G|ann|ABF1 (ABSCISIC ACID RESPONSIVE ELEMENT-BINDING FACTOR 1); DNA binding / protein binding / transcription activator/ transcription factor; Identified as a protein that binds to abscisic acid response elements. May mediate transcriptional regulation of ABA responses.	392	1	QQQQQ	5	100	5	1	213	217	54	NQNSISFNGNNSSMIMNQAPGLGLKVGGTM	PHQQQLQQPHQRLPPTIFPKQANVTFAAPV	GO:0005634:nucleus;GO:0005685:U1 snRNP;	GO:0000398:nuclear mRNA splicing, via spliceosome;GO:0006350:transcription;GO:0006355:regulation of transcription, DNA-dependent;GO:0006950:response to stress;GO:0009738:abscisic acid mediated signaling pathway;GO:0045449:regulation of transcription;	GO:0003677:DNA binding;GO:0003700:sequence-specific DNA binding transcription factor activity;GO:0005515:protein binding;GO:0016563:transcription activator activity;GO:0043565:sequence-specific DNA binding;GO:0046983:protein dimerization activity;	---
>prot|EG:AT1G23000.1-P|cod|AT1G23000.1-TAIR|gene|AT1G23000-TAIR-G|ann|heavy-metal-associated domain-containing protein; heavy-metal-associated domain-containing protein; FUNCTIONS IN: metal ion binding; INVOLVED IN: metal ion transport; LOCATED IN: cellular_component unknown; EXPRESSED IN: 11 plant structures; EXPRESSED DURING: 6 growth stages; CONTAINS InterPro DOMAIN/s: Heavy metal transport/detoxification protein (InterPro:IPR006121); BEST Arabidopsis thaliana protein match is: heavy-metal-associated domain-containing protein (TAIR:AT3G06130.1); Has 1790 Blast hits to 1499 proteins in 100 species: Archae - 0; Bacteria - 31; Metazoa - 175; Fungi - 36; Plants - 724; Viruses - 0; Other Eukaryotes - 824 (source: NCBI BLink).	358	1	QQQQQ	5	100	5	1	150	154	41	GPKGAAFVAEEDGDGSEEEDGDVQFPKPAN	NVVNAKKNSGGAAMNNGNNGVNAASKKVNQ	GO:0005575:cellular_component;	GO:0008150:biological_process;GO:0030001:metal ion transport;	GO:0003674:molecular_function;GO:0046872:metal ion binding;	---
>prot|EG:AT1G49600.1-P|cod|AT1G49600.1-TAIR|gene|AT1G49600-TAIR-G|ann|ATRBP47A (Arabidopsis thaliana RNA-binding protein 47a); RNA binding; Arabidopsis thaliana RNA-binding protein 47a (ATRBP47A); FUNCTIONS IN: RNA binding; EXPRESSED IN: 24 plant structures; EXPRESSED DURING: 14 growth stages; CONTAINS InterPro DOMAIN/s: RNA recognition motif, RNP-1 (InterPro:IPR000504), Nucleotide-binding, alpha-beta plait (InterPro:IPR012677); BEST Arabidopsis thaliana protein match is: ATRBP47B (RNA-binding protein 47B); RNA binding (TAIR:AT3G19130.1); Has 39346 Blast hits to 20025 proteins in 756 species: Archae - 10; Bacteria - 1779; Metazoa - 20670; Fungi - 4118; Plants - 4813; Viruses - 60; Other Eukaryotes - 7896 (source: NCBI BLink).	445	2	QQQQQQQWQQQQQ	13	92.3076923076923	7	0.538461538461538	35	47	7	NNNGSTDSVLPPTSAGTTPPPPLQQSTPPP	WMAAMQQYPAAAMAMMQQQQMMMYPHPQYA	---	---	GO:0003676:nucleic acid binding;GO:0003723:RNA binding;	---
>prot|EG:AT1G49600.1-P|cod|AT1G49600.1-TAIR|gene|AT1G49600-TAIR-G|ann|ATRBP47A (Arabidopsis thaliana RNA-binding protein 47a); RNA binding; Arabidopsis thaliana RNA-binding protein 47a (ATRBP47A); FUNCTIONS IN: RNA binding; EXPRESSED IN: 24 plant structures; EXPRESSED DURING: 14 growth stages; CONTAINS InterPro DOMAIN/s: RNA recognition motif, RNP-1 (InterPro:IPR000504), Nucleotide-binding, alpha-beta plait (InterPro:IPR012677); BEST Arabidopsis thaliana protein match is: ATRBP47B (RNA-binding protein 47B); RNA binding (TAIR:AT3G19130.1); Has 39346 Blast hits to 20025 proteins in 756 species: Archae - 10; Bacteria - 1779; Metazoa - 20670; Fungi - 4118; Plants - 4813; Viruses - 60; Other Eukaryotes - 7896 (source: NCBI BLink).	445	2	QQQQQQHHQSQQQ	13	76.9230769230769	6	0.461538461538462	96	108	21	QQMMMYPHPQYAPYNQAAYQQHPQFQYAAY	PRGGSGGDDVKTLWVGDLLHWMDETYLHTC	---	---	GO:0003676:nucleic acid binding;GO:0003723:RNA binding;	---
>prot|EG:AT5G41410.1-P|cod|AT5G41410.1-TAIR|gene|AT5G41410-TAIR-G|ann|BEL1 (BELL 1); DNA binding / protein binding / transcription factor; Homeodomain protein required for ovule identity.Loss of function mutations show homeotic conversion of integuments to carpels.Forms heterodimers with STM and KNAT1. Interacts with AG-SEP heterodimers is thought to restrict WUS expression. BEL interacts with MADS box dimers composed of SEP1(or SEP3) and AG, SHP1, SHP2 and STK. The interaction of BEL1 with AG-SEP3 is required for proper integument development and specification of integument identity.	611	1	QQQQQQ	6	100	6	1	144	149	23	PPQRPSQGLSLSLSSSNPTSISLQSFELRP	GYSGNKSTQHQNLQHTQMMMMMMNSHHQNN	GO:0005634:nucleus;GO:0005829:cytosol;	GO:0006350:transcription;GO:0006355:regulation of transcription, DNA-dependent;GO:0045449:regulation of transcription;GO:0048481:ovule development;	GO:0003677:DNA binding;GO:0003700:sequence-specific DNA binding transcription factor activity;GO:0005515:protein binding;GO:0030528:transcription regulator activity;GO:0043565:sequence-specific DNA binding;	---
>prot|EG:AT1G19700.2-P|cod|AT1G19700.2-TAIR|gene|AT1G19700-TAIR-G|ann|BEL10 (BEL1-LIKE HOMEODOMAIN 10); DNA binding / transcription factor; Encodes a member of the BEL family of homeodomain proteins. Its interaction with PLP (PAS/LOV PROTEIN) is diminished by blue light.	538	1	QQQQQQ	6	100	6	1	448	453	83	YKEEFGDESELLISKSSQEPNSTNQEDSSS	ENNNNSNLAYSSADTTNIVFSSETKPDRVL	GO:0005634:nucleus;	GO:0006350:transcription;GO:0006355:regulation of transcription, DNA-dependent;GO:0045449:regulation of transcription;	GO:0003677:DNA binding;GO:0003700:sequence-specific DNA binding transcription factor activity;GO:0030528:transcription regulator activity;GO:0043565:sequence-specific DNA binding;	---
>prot|EG:AT2G45620.1-P|cod|AT2G45620.1-TAIR|gene|AT2G45620-TAIR-G|ann|nucleotidyltransferase family protein; nucleotidyltransferase family protein; FUNCTIONS IN: nucleotidyltransferase activity; INVOLVED IN: biological_process unknown; LOCATED IN: cellular_component unknown; EXPRESSED IN: 23 plant structures; EXPRESSED DURING: 14 growth stages; CONTAINS InterPro DOMAIN/s: Nucleotidyltransferase (InterPro:IPR002934), PAP/25A-associated (InterPro:IPR002058); BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT3G45750.1); Has 1532 Blast hits to 1443 proteins in 168 species: Archae - 0; Bacteria - 5; Metazoa - 813; Fungi - 252; Plants - 82; Viruses - 0; Other Eukaryotes - 380 (source: NCBI BLink).	764	1	QQQQQQQ	7	100	7	1	138	144	18	QFDGNQRVSPEDAYRLGFPGTTNPAIQSMV	LPPPQSETRKLVFGSFSGDATQSLNGLHNG	GO:0005575:cellular_component;	GO:0008150:biological_process;	GO:0016779:nucleotidyltransferase activity;	---
>prot|EG:AT5G47175.1-P|cod|AT5G47175.1-TAIR|gene|AT5G47175-TAIR-G|ann|LCR3 (Low-molecular-weight cysteine-rich 3); Encodes a member of a family of small,secreted, cysteine rich protein with sequence similarity to the PCP (pollen coat protein) gene family.	78	1	QQQQQ	5	100	5	1	25	29	32	MTKSIISAFFIILILGMMVNEIEGQQQQQR	RCEEALTEIDCGAGNCNALCLQKRKGLGRC	GO:0005576:extracellular region;GO:0012505:endomembrane system;	GO:0006952:defense response;	---	---
>prot|EG:AT5G17510.1-P|cod|AT5G17510.1-TAIR|gene|AT5G17510-TAIR-G|ann|unknown protein; unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: cellular_component unknown; EXPRESSED IN: 23 plant structures; EXPRESSED DURING: 13 growth stages; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT3G03460.1); Has 22577 Blast hits to 10768 proteins in 507 species: Archae - 4; Bacteria - 485; Metazoa - 8864; Fungi - 2539; Plants - 1455; Viruses - 66; Other Eukaryotes - 9164 (source: NCBI BLink).	369	3	QQQQQQQQ	8	100	8	1	15	22	4	MEDTKPPLGGNNNPQQQQQQQQLLYQHQLQ	LLYQHQLQQQQRQQQMLLLQQLQKQQQQQA	GO:0005575:cellular_component;	GO:0008150:biological_process;GO:0022900:electron transport chain;	GO:0003674:molecular_function;GO:0005506:iron ion binding;GO:0009055:electron carrier activity;GO:0020037:heme binding;	---
>prot|EG:AT5G17510.1-P|cod|AT5G17510.1-TAIR|gene|AT5G17510-TAIR-G|ann|unknown protein; unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: cellular_component unknown; EXPRESSED IN: 23 plant structures; EXPRESSED DURING: 13 growth stages; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT3G03460.1); Has 22577 Blast hits to 10768 proteins in 507 species: Archae - 4; Bacteria - 485; Metazoa - 8864; Fungi - 2539; Plants - 1455; Viruses - 66; Other Eukaryotes - 9164 (source: NCBI BLink).	369	3	QQLQKQQQQQ	10	80	5	0.5	42	51	11	NNPQQQQQQQQLLYQHQLQQQQRQQQMLLL	AAMSRFPSNIDVHLRPPGLIQNRPINPPPQ	GO:0005575:cellular_component;	GO:0008150:biological_process;GO:0022900:electron transport chain;	GO:0003674:molecular_function;GO:0005506:iron ion binding;GO:0009055:electron carrier activity;GO:0020037:heme binding;	---
>prot|EG:AT5G17510.1-P|cod|AT5G17510.1-TAIR|gene|AT5G17510-TAIR-G|ann|unknown protein; unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: cellular_component unknown; EXPRESSED IN: 23 plant structures; EXPRESSED DURING: 13 growth stages; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT3G03460.1); Has 22577 Blast hits to 10768 proteins in 507 species: Archae - 4; Bacteria - 485; Metazoa - 8864; Fungi - 2539; Plants - 1455; Viruses - 66; Other Eukaryotes - 9164 (source: NCBI BLink).	369	3	QQQQQQNVSSQQMMQQQQQQQQQQ	24	75	10	0.416666666666667	98	121	26	PGLIQNRPINPPPQQNPTPNPNLGQQTPNF	KLMRPLNHIELQCAYQDAWRVCHPNFKQPF	GO:0005575:cellular_component;	GO:0008150:biological_process;GO:0022900:electron transport chain;	GO:0003674:molecular_function;GO:0005506:iron ion binding;GO:0009055:electron carrier activity;GO:0020037:heme binding;	---
>prot|EG:AT3G06490.1-P|cod|AT3G06490.1-TAIR|gene|AT3G06490-TAIR-G|ann|MYB108 (myb domain protein 108); DNA binding / transcription factor; putative transcription factor MYB108 (MYB108) mRNA,	323	1	QQQQQ	5	100	5	1	312	316	96	LSWFENINGAASSSDSLWNIGETDEEFWFL	FNNNGSF	GO:0005634:nucleus;	GO:0006355:regulation of transcription, DNA-dependent;GO:0009620:response to fungus;GO:0009651:response to salt stress;GO:0009723:response to ethylene stimulus;GO:0009737:response to abscisic acid stimulus;GO:0009753:response to jasmonic acid stimulus;GO:0045449:regulation of transcription;	GO:0003677:DNA binding;GO:0003700:sequence-specific DNA binding transcription factor activity;	---
>prot|EG:AT3G10760.1-P|cod|AT3G10760.1-TAIR|gene|AT3G10760-TAIR-G|ann|myb family transcription factor; myb family transcription factor; FUNCTIONS IN: transcription factor activity, DNA binding; INVOLVED IN: regulation of transcription; EXPRESSED IN: 22 plant structures; EXPRESSED DURING: 13 growth stages; CONTAINS InterPro DOMAIN/s: Homeodomain-like (InterPro:IPR009057), Myb, DNA-binding (InterPro:IPR014778), Myb-type HTH DNA-binding domain (InterPro:IPR017930), Myb-like DNA-binding region, SHAQKYF class (InterPro:IPR006447), Homeodomain-related (InterPro:IPR012287); BEST Arabidopsis thaliana protein match is: myb family transcription factor (TAIR:AT5G05090.1); Has 941 Blast hits to 938 proteins in 54 species: Archae - 0; Bacteria - 2; Metazoa - 25; Fungi - 6; Plants - 889; Viruses - 0; Other Eukaryotes - 19 (source: NCBI BLink).	335	1	QQQQQ	5	100	5	1	214	218	63	SSPVPAHFLHPNRVPSSDHFMPSFVPIATL	MAAAAAAAAAANPHLQPPQFHRQIAAAHFG	GO:0005634:nucleus;	GO:0045449:regulation of transcription;	GO:0003677:DNA binding;GO:0003700:sequence-specific DNA binding transcription factor activity;	---
>prot|EG:AT5G46640.1-P|cod|AT5G46640.1-TAIR|gene|AT5G46640-TAIR-G|ann|DNA-binding family protein; DNA-binding family protein; FUNCTIONS IN: DNA binding; EXPRESSED IN: 19 plant structures; EXPRESSED DURING: 6 growth stages; CONTAINS InterPro DOMAIN/s: Protein of unknown function DUF296 (InterPro:IPR005175), AT hook, DNA-binding, conserved site (InterPro:IPR017956); BEST Arabidopsis thaliana protein match is: DNA-binding family protein (TAIR:AT4G17950.1); Has 568 Blast hits to 566 proteins in 77 species: Archae - 0; Bacteria - 71; Metazoa - 61; Fungi - 2; Plants - 415; Viruses - 0; Other Eukaryotes - 19 (source: NCBI BLink).	386	2	QQQQQQMDQ	9	77.7777777777778	6	0.666666666666667	62	70	16	SPLMVPTSTSQPIQHPRLPFGNQQQSQTFH	KTLESLGFGDGSPSSQPMRFGIDDQNQQLQ	---	---	GO:0003677:DNA binding;	---
>prot|EG:AT5G46640.1-P|cod|AT5G46640.1-TAIR|gene|AT5G46640-TAIR-G|ann|DNA-binding family protein; DNA-binding family protein; FUNCTIONS IN: DNA binding; EXPRESSED IN: 19 plant structures; EXPRESSED DURING: 6 growth stages; CONTAINS InterPro DOMAIN/s: Protein of unknown function DUF296 (InterPro:IPR005175), AT hook, DNA-binding, conserved site (InterPro:IPR017956); BEST Arabidopsis thaliana protein match is: DNA-binding family protein (TAIR:AT4G17950.1); Has 568 Blast hits to 566 proteins in 77 species: Archae - 0; Bacteria - 71; Metazoa - 61; Fungi - 2; Plants - 415; Viruses - 0; Other Eukaryotes - 19 (source: NCBI BLink).	386	2	QQQQQQQ	7	100	7	1	361	367	93	SQGPSSESSEENESGSPAMHRDNNNGIYGA	PLHPHQMQMYQHLWSNHGQ	---	---	GO:0003677:DNA binding;	---
>prot|EG:AT5G53180.1-P|cod|AT5G53180.1-TAIR|gene|AT5G53180-TAIR-G|ann|PTB2 (POLYPYRIMIDINE TRACT-BINDING PROTEIN 2); RNA binding / nucleic acid binding / nucleotide binding; Encodes one of the two polypyrimidine tract-binding (PTB) protein homologs in the Arabidopsis genome. Double mutants have defects in pollen germination.	429	1	QQQQQPQ	7	85.7142857142857	5	0.714285714285714	372	378	86	NPPVPMPQQPVQNPYAGNPQQYHAAGGSHH	GGWVQPGGQGSMGMGGGGHNHYMAPPSSSS	GO:0005634:nucleus;GO:0005737:cytoplasm;	GO:0006397:mRNA processing;GO:0008380:RNA splicing;GO:0009846:pollen germination;	GO:0000166:nucleotide binding;GO:0003676:nucleic acid binding;GO:0003723:RNA binding;	---
>prot|EG:AT1G19220.1-P|cod|AT1G19220.1-TAIR|gene|AT1G19220-TAIR-G|ann|ARF19 (AUXIN RESPONSE FACTOR 19); DNA binding / transcription factor; Encodes an auxin response factor that contains the conserved VP1-B3 DNA-binding domain at its N-terminus and the Aux/IAA-like domains III and IV present in most ARFs at its C-terminus. The protein interacts with IAA1 (yeast two hybrid) and other auxin response elements such as ER7 and ER9 (yeast one hybrid). ARF19 protein can complement many aspects of the arf7 mutant phenotype and , together with ARF7, is involved in the response to ethylene. In the arf7 arf19 double mutant, several auxin-responsive genes (e.g. IAA5, LBD16, LBD29 and LBD33) are no longer upregulated by auxin.	1086	2	QQQQQQQQQQHQHQQQQLQQQQQLQMSQQQVQQQ	34	79.4117647058823	10	0.294117647058824	495	528	45	LSSANSQFNKPNTVNHISQQMQAQPAMVKS	GIYNNGTIAVANQVSCQSPNQPTGFSQSQL	GO:0005634:nucleus;	GO:0006350:transcription;GO:0006355:regulation of transcription, DNA-dependent;GO:0009723:response to ethylene stimulus;GO:0009725:response to hormone stimulus;GO:0009733:response to auxin stimulus;GO:0009734:auxin mediated signaling pathway;GO:0010386:lateral root primordium development;GO:0045449:regulation of transcription;GO:0048366:leaf development;GO:0048527:lateral root development;	GO:0003677:DNA binding;GO:0003700:sequence-specific DNA binding transcription factor activity;GO:0046983:protein dimerization activity;	---
>prot|EG:AT1G19220.1-P|cod|AT1G19220.1-TAIR|gene|AT1G19220-TAIR-G|ann|ARF19 (AUXIN RESPONSE FACTOR 19); DNA binding / transcription factor; Encodes an auxin response factor that contains the conserved VP1-B3 DNA-binding domain at its N-terminus and the Aux/IAA-like domains III and IV present in most ARFs at its C-terminus. The protein interacts with IAA1 (yeast two hybrid) and other auxin response elements such as ER7 and ER9 (yeast one hybrid). ARF19 protein can complement many aspects of the arf7 mutant phenotype and , together with ARF7, is involved in the response to ethylene. In the arf7 arf19 double mutant, several auxin-responsive genes (e.g. IAA5, LBD16, LBD29 and LBD33) are no longer upregulated by auxin.	1086	2	QQQQQQQ	7	100	7	1	655	661	60	SQNPQQLQMQQQSSKPSPSQQLQLQLLQKL	SIPPVSSSLQPQLSALQQTQSHQLQQLLSS	GO:0005634:nucleus;	GO:0006350:transcription;GO:0006355:regulation of transcription, DNA-dependent;GO:0009723:response to ethylene stimulus;GO:0009725:response to hormone stimulus;GO:0009733:response to auxin stimulus;GO:0009734:auxin mediated signaling pathway;GO:0010386:lateral root primordium development;GO:0045449:regulation of transcription;GO:0048366:leaf development;GO:0048527:lateral root development;	GO:0003677:DNA binding;GO:0003700:sequence-specific DNA binding transcription factor activity;GO:0046983:protein dimerization activity;	---
>prot|EG:AT5G17830.1-P|cod|AT5G17830.1-TAIR|gene|AT5G17830-TAIR-G|ann|unknown protein; unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: cellular_component unknown; EXPRESSED IN: leaf whorl, sepal, flower; EXPRESSED DURING: petal differentiation and expansion stage; CONTAINS InterPro DOMAIN/s: Protein of unknown function DUF580 (InterPro:IPR007603); BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT3G04440.1); Has 161 Blast hits to 161 proteins in 52 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 51; Plants - 87; Viruses - 0; Other Eukaryotes - 23 (source: NCBI BLink).	474	1	QQQQQQPQQQ	10	90	6	0.6	35	44	7	IQISQRNDVGCETCVPRNEIEQQPVTPPAA	TLSGRFFRCLFTCIFYTQLTLISIFVILLT	GO:0005575:cellular_component;GO:0016020:membrane;GO:0016021:integral to membrane;	GO:0006835:dicarboxylic acid transport;GO:0008150:biological_process;	GO:0003674:molecular_function;GO:0017153:sodium:dicarboxylate symporter activity;	---
>prot|EG:AT5G02030.1-P|cod|AT5G02030.1-TAIR|gene|AT5G02030-TAIR-G|ann|RPL (REPLUMLESS); DNA binding / sequence-specific DNA binding / transcription factor; Mutant has additional lateral organs and phyllotaxy defect. Encodes a homeodomain transcription factor. Has sequence similarity to the Arabidopsis ovule development regulator Bell1. Binds directly to the AGAMOUS cis-regulatory element. Its localization to the nucleus is dependent on the coexpression of either STM or BP.	575	1	QQQQQ	5	100	5	1	303	307	52	NLALKALSKHFKCLKNAITDQLQFSHNNKI	CGHPMNSENKTDSLRFGGSDSSRGLCSAGQ	GO:0005634:nucleus;GO:0005829:cytosol;	GO:0006350:transcription;GO:0006355:regulation of transcription, DNA-dependent;GO:0007389:pattern specification process;GO:0010051:xylem and phloem pattern formation;GO:0010076:maintenance of floral meristem identity;GO:0010077:maintenance of inflorescence meristem identity;GO:0010154:fruit development;GO:0010223:secondary shoot formation;GO:0010228:vegetative to reproductive phase transition of meristem;GO:0016481:negative regulation of transcription;GO:0045449:regulation of transcription;GO:0048367:shoot development;GO:0048457:floral whorl morphogenesis;GO:0048645:organ formation;GO:0080006:internode patterning;	GO:0003677:DNA binding;GO:0003700:sequence-specific DNA binding transcription factor activity;GO:0005515:protein binding;GO:0030528:transcription regulator activity;GO:0043565:sequence-specific DNA binding;	---
>prot|EG:AT1G03457.1-P|cod|AT1G03457.1-TAIR|gene|AT1G03457-TAIR-G|ann|RNA-binding protein, putative; RNA-binding protein, putative; FUNCTIONS IN: RNA binding, nucleotide binding, nucleic acid binding; INVOLVED IN: biological_process unknown; LOCATED IN: cellular_component unknown; EXPRESSED IN: 17 plant structures; EXPRESSED DURING: 14 growth stages; CONTAINS InterPro DOMAIN/s: RNA recognition motif, RNP-1 (InterPro:IPR000504), Ribonucleoprotein, BRUNO-like (InterPro:IPR015903), Nucleotide-binding, alpha-beta plait (InterPro:IPR012677), Paraneoplastic encephalomyelitis antigen (InterPro:IPR002343); BEST Arabidopsis thaliana protein match is: RNA-binding protein, putative (TAIR:AT4G03110.1); Has 21968 Blast hits to 12589 proteins in 581 species: Archae - 14; Bacteria - 954; Metazoa - 13308; Fungi - 2195; Plants - 3046; Viruses - 0; Other Eukaryotes - 2451 (source: NCBI BLink).	429	1	QQQQQQQ	7	100	7	1	411	417	95	QAAAQNAINTMNGCQLSGKKLKVQLKRDNG	SKNPLFNGLLNS	GO:0005575:cellular_component;GO:0030529:ribonucleoprotein complex;	GO:0008150:biological_process;	GO:0000166:nucleotide binding;GO:0003676:nucleic acid binding;GO:0003723:RNA binding;	---
>prot|EG:AT3G21270.1-P|cod|AT3G21270.1-TAIR|gene|AT3G21270-TAIR-G|ann|ADOF2; DNA binding / transcription factor; Encodes Dof zinc finger protein adof2.	204	1	QQQQQQPQ	8	87.5	6	0.75	15	22	7	MQDPAAYYQTMMAKQQQQQQPQFAEQEQLK	FAEQEQLKCPRCDSPNTKFCYYNNYNLSQP	GO:0005575:cellular_component;GO:0005634:nucleus;	GO:0006350:transcription;GO:0045449:regulation of transcription;	GO:0003677:DNA binding;GO:0003700:sequence-specific DNA binding transcription factor activity;GO:0008270:zinc ion binding;GO:0046872:metal ion binding;	---
>prot|EG:AT5G05410.1-P|cod|AT5G05410.1-TAIR|gene|AT5G05410-TAIR-G|ann|DREB2A; DNA binding / transcription activator/ transcription factor; Encodes a transcription factor that specifically binds to DRE/CRT cis elements (responsive to drought and low-temperature stress). Belongs to the DREB subfamily A-2 of ERF/AP2 transcription factor family (DREB2A). There are eight members in this subfamily including DREB2B. The protein contains one AP2 domain. Overexpression of transcriptional activation domain of DREB2A resulted in significant drought stress tolerance but only slight freezing tolerance in transgenic Arabidopsis plants. Microarray and RNA gel blot analyses revealed that DREB2A regulates expression of many water stress–inducible genes.	335	1	QQQQQ	5	100	5	1	230	234	68	HWLSEFEHNYWSDILKEKEKQKEQGIVETC	DSLSVADYGWPNDVDQSHLDSSDMFDVDEL	GO:0005634:nucleus;	GO:0006350:transcription;GO:0006355:regulation of transcription, DNA-dependent;GO:0006950:response to stress;GO:0009408:response to heat;GO:0009414:response to water deprivation;GO:0010224:response to UV-B;GO:0010286:heat acclimation;GO:0042542:response to hydrogen peroxide;GO:0045449:regulation of transcription;	GO:0003677:DNA binding;GO:0003700:sequence-specific DNA binding transcription factor activity;GO:0005515:protein binding;GO:0016563:transcription activator activity;	---
>prot|EG:AT3G14100.1-P|cod|AT3G14100.1-TAIR|gene|AT3G14100-TAIR-G|ann|oligouridylate-binding protein, putative; oligouridylate-binding protein, putative; FUNCTIONS IN: mRNA 3'-UTR binding; EXPRESSED IN: 25 plant structures; EXPRESSED DURING: 14 growth stages; CONTAINS InterPro DOMAIN/s: RNA recognition motif, RNP-1 (InterPro:IPR000504), Nucleotide-binding, alpha-beta plait (InterPro:IPR012677); BEST Arabidopsis thaliana protein match is: oligouridylate-binding protein, putative (TAIR:AT1G54080.1); Has 21621 Blast hits to 14687 proteins in 586 species: Archae - 0; Bacteria - 979; Metazoa - 12825; Fungi - 2452; Plants - 3119; Viruses - 0; Other Eukaryotes - 2246 (source: NCBI BLink).	427	1	QHQQQQQQQ	9	88.8888888888889	7	0.777777777777778	8	16	1	MQNPRLKQHQQQQQQQAMMQQQALMQQHSL	AMMQQQALMQQHSLYHPGVLAPPQLEPVPS	---	---	GO:0000166:nucleotide binding;GO:0003676:nucleic acid binding;GO:0003730:mRNA 3'-UTR binding;	---
>prot|EG:AT1G18750.2-P|cod|AT1G18750.2-TAIR|gene|AT1G18750-TAIR-G|ann|AGL65 (AGAMOUS-LIKE 65); DNA binding / transcription factor; Encodes a member of the MIKC (MADS box, Keratin binding domain, and C terminal domain containing )family of transcriptional regulators. AGL65 is expressed in pollen.It forms heterodimers with other MICK family members (AGL104). Involved in late stages of pollen development and pollen tube growth.	334	1	QQQQQQQQQQQQQ	13	100	13	1	266	278	79	YSYPTPFGTTLGMEEDQEKKIKSEMELNNL	DPSMYDPMANNNGGCFQIPHDQSMFVNDHH	GO:0005634:nucleus;	GO:0006350:transcription;GO:0006355:regulation of transcription, DNA-dependent;GO:0009555:pollen development;GO:0045449:regulation of transcription;	GO:0003677:DNA binding;GO:0003700:sequence-specific DNA binding transcription factor activity;GO:0005515:protein binding;GO:0016491:oxidoreductase activity;GO:0043565:sequence-specific DNA binding;	---
>prot|EG:AT5G32215.1-P|cod|AT5G32215.1-TAIR|gene|AT5G32215-TAIR-G|ann|transposable element gene; gypsy-like retrotransposon family (Athila), has a 4.6e-306 P-value blast match to GB:CAA57397 Athila ORF 1 (Arabidopsis thaliana)	911	1	QQQQQ	5	100	5	1	392	396	43	FVPYNQGQGYVPKQQYQGNYQQQLPPPGFT	PASTTPDSDLKNMLQQILQGQAAGAMDLAK	GO:0005575:cellular_component;	GO:0006508:proteolysis;GO:0008150:biological_process;	GO:0003674:molecular_function;GO:0004190:aspartic-type endopeptidase activity;	---
>prot|EG:AT3G44340.2-P|cod|AT3G44340.2-TAIR|gene|AT3G44340-TAIR-G|ann|CEF (clone eighty-four); protein binding / transporter/ zinc ion binding; homologous to yeast and animal Sec24 proteins; expression in yeast cells enhances their survival under oxidative stress conditions.	1069	1	QQQQQQ	6	100	6	1	72	77	6	NLNINRPPPPMPGSGPRPSPPFGQSPQSFP	PRPSPMARPGPPPPAAMARPGGPPQVSQPG	GO:0000139:Golgi membrane;GO:0005783:endoplasmic reticulum;GO:0005789:endoplasmic reticulum membrane;GO:0005794:Golgi apparatus;GO:0009507:chloroplast;GO:0016020:membrane;GO:0030127:COPII vesicle coat;GO:0033116:ER-Golgi intermediate compartment membrane;	GO:0006810:transport;GO:0006886:intracellular protein transport;GO:0006888:ER to Golgi vesicle-mediated transport;GO:0006979:response to oxidative stress;GO:0015031:protein transport;GO:0016192:vesicle-mediated transport;	GO:0005215:transporter activity;GO:0005515:protein binding;GO:0008270:zinc ion binding;	---
>prot|EG:AT5G58680.1-P|cod|AT5G58680.1-TAIR|gene|AT5G58680-TAIR-G|ann|armadillo/beta-catenin repeat family protein; armadillo/beta-catenin repeat family protein; FUNCTIONS IN: binding; INVOLVED IN: biological_process unknown; LOCATED IN: cellular_component unknown; EXPRESSED IN: stem, root; CONTAINS InterPro DOMAIN/s: Armadillo-like helical (InterPro:IPR011989), Armadillo (InterPro:IPR000225), Armadillo-type fold (InterPro:IPR016024); BEST Arabidopsis thaliana protein match is: armadillo/beta-catenin repeat family protein (TAIR:AT3G01400.1); Has 3866 Blast hits to 2288 proteins in 207 species: Archae - 0; Bacteria - 2; Metazoa - 1547; Fungi - 362; Plants - 1531; Viruses - 0; Other Eukaryotes - 424 (source: NCBI BLink).	357	1	QPRQQQQQQQ	10	80	7	0.7	339	348	94	GAVPPLVALSQGSASRGAKVKAEALIELLR	HFESNDNER	GO:0005575:cellular_component;	GO:0008150:biological_process;	GO:0005488:binding;	---
>prot|EG:AT5G64240.2-P|cod|AT5G64240.2-TAIR|gene|AT5G64240-TAIR-G|ann|AtMC3 (metacaspase 3); cysteine-type endopeptidase; metacaspase 3 (AtMC3); FUNCTIONS IN: cysteine-type endopeptidase activity; INVOLVED IN: proteolysis; EXPRESSED IN: 20 plant structures; EXPRESSED DURING: 10 growth stages; CONTAINS InterPro DOMAIN/s: Peptidase C14, caspase catalytic (InterPro:IPR011600); BEST Arabidopsis thaliana protein match is: AMC1 (METACASPASE 1); cysteine-type endopeptidase (TAIR:AT1G02170.1); Has 770 Blast hits to 766 proteins in 197 species: Archae - 3; Bacteria - 201; Metazoa - 0; Fungi - 196; Plants - 176; Viruses - 0; Other Eukaryotes - 194 (source: NCBI BLink).	362	1	QQQQQ	5	100	5	1	66	70	18	YSLVDIARGANRIIHGFQQLLRQHQPQHHE	MMAQPPPRLLEPLPSPFGKKRAVLCGVNYK	---	GO:0006508:proteolysis;	GO:0004197:cysteine-type endopeptidase activity;GO:0008233:peptidase activity;GO:0008234:cysteine-type peptidase activity;GO:0016787:hydrolase activity;	---
>prot|EG:AT5G64430.1-P|cod|AT5G64430.1-TAIR|gene|AT5G64430-TAIR-G|ann|octicosapeptide/Phox/Bem1p (PB1) domain-containing protein; octicosapeptide/Phox/Bem1p (PB1) domain-containing protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: chloroplast envelope; EXPRESSED IN: cultured cell; CONTAINS InterPro DOMAIN/s: Octicosapeptide/Phox/Bem1p (InterPro:IPR000270); BEST Arabidopsis thaliana protein match is: octicosapeptide/Phox/Bem1p (PB1) domain-containing protein (TAIR:AT5G09620.1); Has 10197 Blast hits to 7265 proteins in 506 species: Archae - 4; Bacteria - 634; Metazoa - 4503; Fungi - 1666; Plants - 2043; Viruses - 238; Other Eukaryotes - 1109 (source: NCBI BLink).	513	1	QEQQQQQ	7	85.7142857142857	5	0.714285714285714	259	265	50	DPRVIQPDHVVNPMEIQRQMQEFQRMHIRD	EAVYRRKSNEDGLIETGGGYFSPPYIQNPA	GO:0009941:chloroplast envelope;	GO:0008150:biological_process;	GO:0003674:molecular_function;	---
>prot|EG:AT2G01830.3-P|cod|AT2G01830.3-TAIR|gene|AT2G01830-TAIR-G|ann|WOL (WOODEN LEG); cytokinin receptor/ osmosensor/ phosphoprotein phosphatase/ protein histidine kinase; Histidine kinase: cytokinin-binding receptor that transduces cytokinin signals across the plasma membrane	1057	1	QQQQQLQ	7	85.7142857142857	5	0.714285714285714	66	72	6	QLGGGGALNSSEKPRKIDFWRSGLMGFAKM	HSVAVKMNNNNNNDLMGNKKGSTFIQEHRA	GO:0016020:membrane;	GO:0000160:two-component signal transduction system (phosphorelay);GO:0006355:regulation of transcription, DNA-dependent;GO:0006468:protein amino acid phosphorylation;GO:0007165:signal transduction;GO:0009414:response to water deprivation;GO:0009736:cytokinin mediated signaling pathway;GO:0010029:regulation of seed germination;GO:0010086:embryonic root morphogenesis;GO:0016310:phosphorylation;GO:0018106:peptidyl-histidine phosphorylation;GO:0042742:defense response to bacterium;GO:0048831:regulation of shoot development;	GO:0000155:two-component sensor activity;GO:0000156:two-component response regulator activity;GO:0004673:protein histidine kinase activity;GO:0004721:phosphoprotein phosphatase activity;GO:0004871:signal transducer activity;GO:0004872:receptor activity;GO:0005034:osmosensor activity;GO:0005515:protein binding;GO:0005524:ATP binding;GO:0009884:cytokinin receptor activity;GO:0016301:kinase activity;GO:0016772:transferase activity, transferring phosphorus-containing groups;	---
>prot|EG:AT1G79060.1-P|cod|AT1G79060.1-TAIR|gene|AT1G79060-TAIR-G|ann|unknown protein; unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: cellular_component unknown; EXPRESSED IN: 6 plant structures; EXPRESSED DURING: F mature embryo stage, petal differentiation and expansion stage, D bilateral stage, E expanded cotyledon stage; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT1G56020.1); Has 3270 Blast hits to 887 proteins in 158 species: Archae - 0; Bacteria - 617; Metazoa - 634; Fungi - 189; Plants - 72; Viruses - 8; Other Eukaryotes - 1750 (source: NCBI BLink).	396	1	QQQQQ	5	100	5	1	82	86	20	AGDFEFRLEEDPVGMLPADELFSDGKLVTK	TTEIGGKCRRMEVVEIEISGGGDNCSFSPK	GO:0005575:cellular_component;	GO:0008150:biological_process;	GO:0003674:molecular_function;	---
>prot|EG:AT5G35200.1-P|cod|AT5G35200.1-TAIR|gene|AT5G35200-TAIR-G|ann|epsin N-terminal homology (ENTH) domain-containing protein; epsin N-terminal homology (ENTH) domain-containing protein; FUNCTIONS IN: phospholipid binding, clathrin binding, binding, phosphatidylinositol binding; INVOLVED IN: clathrin coat assembly; LOCATED IN: plasma membrane; EXPRESSED IN: 24 plant structures; EXPRESSED DURING: 15 growth stages; CONTAINS InterPro DOMAIN/s: Epsin-like, N-terminal (InterPro:IPR013809), ANTH (InterPro:IPR011417), ENTH/VHS (InterPro:IPR008942), Clathrin adaptor, phosphoinositide-binding, GAT-like (InterPro:IPR014712); BEST Arabidopsis thaliana protein match is: epsin N-terminal homology (ENTH) domain-containing protein (TAIR:AT2G01600.1); Has 641 Blast hits to 626 proteins in 133 species: Archae - 0; Bacteria - 2; Metazoa - 267; Fungi - 96; Plants - 234; Viruses - 0; Other Eukaryotes - 42 (source: NCBI BLink).	544	1	QQPYQQQQQ	9	77.7777777777778	5	0.555555555555556	507	515	93	AAPQPFQMANQNHQTFGYQHQNAGMMMGPV	NMNNPFGNPFVSNGNPQQPQGYNPYPRYM	GO:0005794:Golgi apparatus;GO:0005886:plasma membrane;GO:0005905:coated pit;GO:0016020:membrane;GO:0030118:clathrin coat;GO:0030136:clathrin-coated vesicle;GO:0031410:cytoplasmic vesicle;	GO:0006897:endocytosis;GO:0048268:clathrin coat assembly;	GO:0005488:binding;GO:0005543:phospholipid binding;GO:0005545:phosphatidylinositol binding;GO:0030276:clathrin binding;	---
>prot|EG:AT1G66140.1-P|cod|AT1G66140.1-TAIR|gene|AT1G66140-TAIR-G|ann|ZFP4 (ZINC FINGER PROTEIN 4); nucleic acid binding / transcription factor/ zinc ion binding; Encodes a zinc finger protein containing only a single zinc finger.	260	1	QQQQQQ	6	100	6	1	72	77	27	FNNNNNNNLDLESSSLTLPLSSTSESSNPE	PSVSKRVFSCNYCQRKFYSSQALGGHQNAH	GO:0005622:intracellular;	GO:0006414:translational elongation;GO:0045449:regulation of transcription;	GO:0003676:nucleic acid binding;GO:0003700:sequence-specific DNA binding transcription factor activity;GO:0008270:zinc ion binding;GO:0030533:triplet codon-amino acid adaptor activity;GO:0046872:metal ion binding;	---
>prot|EG:AT2G44410.1-P|cod|AT2G44410.1-TAIR|gene|AT2G44410-TAIR-G|ann|protein binding / zinc ion binding; protein binding / zinc ion binding; FUNCTIONS IN: protein binding, zinc ion binding; EXPRESSED IN: cultured cell; CONTAINS InterPro DOMAIN/s: Zinc finger, RING-type (InterPro:IPR001841), Zinc finger, RING/FYVE/PHD-type (InterPro:IPR013083); BEST Arabidopsis thaliana protein match is: zinc finger (C3HC4-type RING finger) family protein (TAIR:AT3G58030.3); Has 1080 Blast hits to 1080 proteins in 159 species: Archae - 0; Bacteria - 0; Metazoa - 589; Fungi - 94; Plants - 237; Viruses - 7; Other Eukaryotes - 153 (source: NCBI BLink).	413	1	QQQQQQ	6	100	6	1	266	271	64	TIDSIGLQALAQGDEFGLTNIINNGGDNGG	HHHHHHPPFGPLRLLPPYATFPGLLVDTSD	GO:0016021:integral to membrane;	GO:0007186:G-protein coupled receptor protein signaling pathway;	GO:0004974:leukotriene receptor activity;GO:0005515:protein binding;GO:0008270:zinc ion binding;GO:0046872:metal ion binding;	---
>prot|EG:AT5G11710.1-P|cod|AT5G11710.1-TAIR|gene|AT5G11710-TAIR-G|ann|epsin N-terminal homology (ENTH) domain-containing protein / clathrin assembly protein-related; EPSIN1 plays an important role in the vacuolar trafficking of soluble proteins at the trans-Golgi network via its interaction with gamma-ADR, VTI11, VSR1, and clathrin. Associated with actin filaments and with the Golgi complex. Expressed in most tissues.	560	1	QQQQQQQQQQQ	11	100	11	1	526	536	93	DGNKASAASYYSGWSMGAGSGLGKTGLYST	APDISDDFFSSLSNQRYQSGGFKQ	GO:0005794:Golgi apparatus;GO:0005884:actin filament;GO:0009579:thylakoid;	GO:0006623:protein targeting to vacuole;	GO:0005488:binding;GO:0005515:protein binding;	---
>prot|EG:AT3G60240.4-P|cod|AT3G60240.4-TAIR|gene|AT3G60240-TAIR-G|ann|EIF4G (EUKARYOTIC TRANSLATION INITIATION FACTOR 4G); translation initiation factor; protein synthesis initiation factor 4G (EIF4G). A mutation in this gene (cum2-1) results in decreased accumulation of CMV coat protein in upper, uninoculated leaves. Likely affects cell-to-cell movement of the virus, also affects TCV multiplication.	1727	1	QQQQQQ	6	100	6	1	25	30	1	MSYNQSRPDRSETQYRRTGRSTGNQQQQQQ	HRSSSAAGYGKGAGAPGSAPAPSTYPDNSS	---	GO:0006412:translation;GO:0006417:regulation of translation;GO:0009615:response to virus;GO:0016070:RNA metabolic process;	GO:0003723:RNA binding;GO:0003743:translation initiation factor activity;GO:0005488:binding;GO:0005515:protein binding;	---
>prot|EG:AT3G06130.1-P|cod|AT3G06130.1-TAIR|gene|AT3G06130-TAIR-G|ann|heavy-metal-associated domain-containing protein; heavy-metal-associated domain-containing protein; FUNCTIONS IN: metal ion binding; INVOLVED IN: metal ion transport; LOCATED IN: cell wall; EXPRESSED IN: 21 plant structures; EXPRESSED DURING: 13 growth stages; CONTAINS InterPro DOMAIN/s: Heavy metal transport/detoxification protein (InterPro:IPR006121); BEST Arabidopsis thaliana protein match is: heavy-metal-associated domain-containing protein (TAIR:AT5G19090.3); Has 109755 Blast hits to 35195 proteins in 1695 species: Archae - 151; Bacteria - 27140; Metazoa - 47181; Fungi - 6595; Plants - 9363; Viruses - 1377; Other Eukaryotes - 17948 (source: NCBI BLink).	473	1	QMQQQQQQQQ	10	90	8	0.8	387	396	81	GNMPAVQGLPATGPGGAPQGYFQGAGIDPM	YLAAVMNQQRAMGNERFQPMMYARPPPAVN	GO:0005618:cell wall;	GO:0030001:metal ion transport;	GO:0046872:metal ion binding;	---
>prot|EG:AT5G17430.1-P|cod|AT5G17430.1-TAIR|gene|AT5G17430-TAIR-G|ann|BBM (BABY BOOM); DNA binding / transcription factor; Encodes an AP2-domain containing protein similar to ANT. Expressed in embryos and lateral root primordium.	584	1	QHQQQQQIQQ	10	80	5	0.5	537	546	91	FAIPVGTSVNYDPFTAAEIAYNARNHYYYA	SPGGDFPVAISNNHSSNMYFHGEGGGEGAP	GO:0005634:nucleus;	GO:0006350:transcription;GO:0006355:regulation of transcription, DNA-dependent;GO:0007275:multicellular organismal development;GO:0009887:organ morphogenesis;GO:0045449:regulation of transcription;	GO:0003677:DNA binding;GO:0003700:sequence-specific DNA binding transcription factor activity;	---
>prot|EG:AT5G08330.1-P|cod|AT5G08330.1-TAIR|gene|AT5G08330-TAIR-G|ann|TCP family transcription factor, putative; TCP family transcription factor, putative; FUNCTIONS IN: transcription factor activity; INVOLVED IN: regulation of transcription; LOCATED IN: cellular_component unknown; EXPRESSED IN: 21 plant structures; EXPRESSED DURING: 13 growth stages; CONTAINS InterPro DOMAIN/s: Transcription factor, TCP (InterPro:IPR005333), Transcription factor TCP subgroup (InterPro:IPR017887); BEST Arabidopsis thaliana protein match is: TCP family transcription factor, putative (TAIR:AT5G23280.1); Has 741 Blast hits to 732 proteins in 146 species: Archae - 0; Bacteria - 2; Metazoa - 30; Fungi - 0; Plants - 703; Viruses - 0; Other Eukaryotes - 6 (source: NCBI BLink).	239	1	QQQQQ	5	100	5	1	186	190	77	FGQVWSFATGAPPEMVFAQQQQPATLFVRH	ASAAAAAAMGEASAARVGNYLPGHHLNLLA	GO:0005575:cellular_component;GO:0005634:nucleus;	GO:0006350:transcription;GO:0016068:type I hypersensitivity;GO:0045449:regulation of transcription;	GO:0003677:DNA binding;GO:0003700:sequence-specific DNA binding transcription factor activity;	---
>prot|EG:AT5G66770.1-P|cod|AT5G66770.1-TAIR|gene|AT5G66770-TAIR-G|ann|scarecrow transcription factor family protein; scarecrow transcription factor family protein; FUNCTIONS IN: transcription factor activity; INVOLVED IN: regulation of transcription; LOCATED IN: cellular_component unknown; EXPRESSED IN: 21 plant structures; EXPRESSED DURING: 13 growth stages; CONTAINS InterPro DOMAIN/s: GRAS transcription factor (InterPro:IPR005202); BEST Arabidopsis thaliana protein match is: scarecrow-like transcription factor 7 (SCL7) (TAIR:AT3G50650.1); Has 1412 Blast hits to 1381 proteins in 194 species: Archae - 0; Bacteria - 4; Metazoa - 6; Fungi - 4; Plants - 1394; Viruses - 0; Other Eukaryotes - 4 (source: NCBI BLink).	584	1	QKQQQEQQQQQ	11	81.8181818181818	5	0.454545454545455	21	31	3	MAYMCTDSGNLMAIAQQVIKQKQQQEQQQQ	HHQDHQIFGINPLSLNPWPNTSLGFGLSGS	GO:0005575:cellular_component;GO:0005634:nucleus;	GO:0006350:transcription;GO:0045449:regulation of transcription;	GO:0003700:sequence-specific DNA binding transcription factor activity;GO:0005515:protein binding;	---
>prot|EG:AT1G22950.1-P|cod|AT1G22950.1-TAIR|gene|AT1G22950-TAIR-G|ann|iron ion binding / oxidoreductase/ oxidoreductase, acting on paired donors, with incorporation or reduction of molecular oxygen, 2-oxoglutarate as one donor, and incorporation of one atom each of oxygen into both donors; iron ion binding / oxidoreductase/ oxidoreductase, acting on paired donors, with incorporation or reduction of molecular oxygen, 2-oxoglutarate as one donor, and incorporation of one atom each of oxygen into both donors; FUNCTIONS IN: oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, 2-oxoglutarate as one donor, and incorporation of one atom each of oxygen into both donors, oxidoreductase activity, iron ion binding; INVOLVED IN: protein metabolic process; LOCATED IN: cellular_component unknown; CONTAINS InterPro DOMAIN/s: Prolyl 4-hydroxylase, alpha subunit (InterPro:IPR006620), 2OG-Fe(II) oxygenase (InterPro:IPR005123); BEST Arabidopsis thaliana protein match is: oxidoreductase, 2OG-Fe(II) oxygenase family protein (TAIR:AT3G18210.2); Has 343 Blast hits to 342 proteins in 56 species: Archae - 0; Bacteria - 16; Metazoa - 252; Fungi - 0; Plants - 36; Viruses - 3; Other Eukaryotes - 36 (source: NCBI BLink).	397	1	QPEQQQQQQ	9	77.7777777777778	6	0.666666666666667	18	26	4	MCNQTPLRSMALDSSGKQPEQQQQQQPRAS	PRASSGNGEARLKLRRTPNEEHEPENYEDL	GO:0005575:cellular_component;	GO:0019538:protein metabolic process;GO:0055114:oxidation reduction;	GO:0005506:iron ion binding;GO:0016491:oxidoreductase activity;GO:0016702:oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen;GO:0016705:oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen;GO:0016706:oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, 2-oxoglutarate as one donor, and incorporation of one atom each of oxygen into both donors;GO:0031418:L-ascorbic acid binding;GO:0046872:metal ion binding;	---
>prot|EG:AT5G13480.1-P|cod|AT5G13480.1-TAIR|gene|AT5G13480-TAIR-G|ann|FY; protein binding; Encodes a protein with similarity to yeast Pfs2p, an mRNA processing factor. Involved in regulation of flowering time; affects FCA mRNA processing. Homozygous mutants are late flowering, null alleles are embryo lethal.	647	2	QQQGYQQQQQHQ	12	75	5	0.416666666666667	503	514	77	GDHKQPLPGSMALGAPPLPPGPHPSLLGSG	GHPQQMLPMPNMPHHQLPPSSHMPLHPHHL	GO:0080008:CUL4 RING ubiquitin ligase complex;	GO:0006397:mRNA processing;GO:0009793:embryo development ending in seed dormancy;GO:0009909:regulation of flower development;	GO:0005515:protein binding;	---
>prot|EG:AT5G13480.1-P|cod|AT5G13480.1-TAIR|gene|AT5G13480-TAIR-G|ann|FY; protein binding; Encodes a protein with similarity to yeast Pfs2p, an mRNA processing factor. Involved in regulation of flowering time; affects FCA mRNA processing. Homozygous mutants are late flowering, null alleles are embryo lethal.	647	2	QQQQQ	5	100	5	1	627	631	96	QPNSGGPQMYPQGRGGFNRPQMIPGYNNPF	PPLPPGPPPNNNQQHQ	GO:0080008:CUL4 RING ubiquitin ligase complex;	GO:0006397:mRNA processing;GO:0009793:embryo development ending in seed dormancy;GO:0009909:regulation of flower development;	GO:0005515:protein binding;	---
>prot|EG:AT1G19790.2-P|cod|AT1G19790.2-TAIR|gene|AT1G19790-TAIR-G|ann|SRS7 (SHI-RELATED SEQUENCE 7); A member of SHI gene family. Arabidopsis thaliana has ten members that encode proteins with a RING finger-like zinc finger motif. Despite being highly divergent in sequence, many of the SHI-related genes are partially redundant in function and synergistically promote gynoecium, stamen and leaf development in Arabidopsis.	345	1	QYFQQQQQQ	9	77.7777777777778	6	0.666666666666667	52	60	15	DHNEDKSNNYLYLYKDEIYNNNKGFEIFPP	NHAAAPTNLYSFGMVPSGGNINNNRSTNRS	GO:0005575:cellular_component;	GO:0008150:biological_process;	GO:0003674:molecular_function;	---
>prot|EG:AT1G31140.1-P|cod|AT1G31140.1-TAIR|gene|AT1G31140-TAIR-G|ann|agl63 (AGAMOUS-LIKE 63); DNA binding / transcription factor; AGAMOUS-LIKE 63 (agl63); FUNCTIONS IN: transcription factor activity, DNA binding; INVOLVED IN: regulation of transcription, DNA-dependent; LOCATED IN: nucleus; CONTAINS InterPro DOMAIN/s: Transcription factor, MADS-box (InterPro:IPR002100), Transcription factor, K-box (InterPro:IPR002487); BEST Arabidopsis thaliana protein match is: AGL42 (AGAMOUS LIKE 42); transcription factor (TAIR:AT5G62165.3); Has 4557 Blast hits to 4557 proteins in 633 species: Archae - 0; Bacteria - 0; Metazoa - 551; Fungi - 201; Plants - 3754; Viruses - 0; Other Eukaryotes - 51 (source: NCBI BLink).	213	1	QQQQQQTDQ	9	77.7777777777778	6	0.666666666666667	149	157	69	LLTYDELLSFELHLESSLQHARARKSEFMH	KLKGKEKGQGSSWEQLMWQAERQMMTCQRQ	GO:0005634:nucleus;	GO:0006350:transcription;GO:0006355:regulation of transcription, DNA-dependent;GO:0045449:regulation of transcription;	GO:0003677:DNA binding;GO:0003700:sequence-specific DNA binding transcription factor activity;GO:0005515:protein binding;GO:0043565:sequence-specific DNA binding;	---
>prot|EG:AT4G32760.1-P|cod|AT4G32760.1-TAIR|gene|AT4G32760-TAIR-G|ann|protein transporter; protein transporter; FUNCTIONS IN: protein transporter activity; INVOLVED IN: intracellular protein transport, intra-Golgi vesicle-mediated transport; LOCATED IN: Golgi stack, plasma membrane; EXPRESSED IN: 24 plant structures; EXPRESSED DURING: 15 growth stages; CONTAINS InterPro DOMAIN/s: VHS (InterPro:IPR002014), GAT (InterPro:IPR004152), VHS subgroup (InterPro:IPR018205), ENTH/VHS (InterPro:IPR008942); BEST Arabidopsis thaliana protein match is: VHS domain-containing protein / GAT domain-containing protein (TAIR:AT3G08790.1); Has 18386 Blast hits to 12933 proteins in 541 species: Archae - 4; Bacteria - 507; Metazoa - 7666; Fungi - 3474; Plants - 2212; Viruses - 64; Other Eukaryotes - 4459 (source: NCBI BLink).	675	2	QPQQQQQQQ	9	88.8888888888889	7	0.777777777777778	560	568	82	AVANISPYPQIPQNGVYMPNQPNQALGSGY	MMMAQYYAQQQQLQQQQQQQAYGNQMGGYG	GO:0005622:intracellular;GO:0005795:Golgi stack;GO:0005886:plasma membrane;	GO:0006886:intracellular protein transport;GO:0006891:intra-Golgi vesicle-mediated transport;	GO:0008565:protein transporter activity;	---
>prot|EG:AT4G32760.1-P|cod|AT4G32760.1-TAIR|gene|AT4G32760-TAIR-G|ann|protein transporter; protein transporter; FUNCTIONS IN: protein transporter activity; INVOLVED IN: intracellular protein transport, intra-Golgi vesicle-mediated transport; LOCATED IN: Golgi stack, plasma membrane; EXPRESSED IN: 24 plant structures; EXPRESSED DURING: 15 growth stages; CONTAINS InterPro DOMAIN/s: VHS (InterPro:IPR002014), GAT (InterPro:IPR004152), VHS subgroup (InterPro:IPR018205), ENTH/VHS (InterPro:IPR008942); BEST Arabidopsis thaliana protein match is: VHS domain-containing protein / GAT domain-containing protein (TAIR:AT3G08790.1); Has 18386 Blast hits to 12933 proteins in 541 species: Archae - 4; Bacteria - 507; Metazoa - 7666; Fungi - 3474; Plants - 2212; Viruses - 64; Other Eukaryotes - 4459 (source: NCBI BLink).	675	2	QYYAQQQQLQQQQQQQ	16	75	7	0.4375	573	588	84	NGVYMPNQPNQALGSGYQPQQQQQQQMMMA	AYGNQMGGYGYGYNQQQQGSSPYLDQQMYG	GO:0005622:intracellular;GO:0005795:Golgi stack;GO:0005886:plasma membrane;	GO:0006886:intracellular protein transport;GO:0006891:intra-Golgi vesicle-mediated transport;	GO:0008565:protein transporter activity;	---
>prot|EG:AT5G37020.2-P|cod|AT5G37020.2-TAIR|gene|AT5G37020-TAIR-G|ann|ARF8 (AUXIN RESPONSE FACTOR 8); transcription factor; Encodes a member of the auxin response factor family. Mediates auxin response via expression of auxin regulated genes. Acts redundantly with ARF6 to control stamen elongation and flower maturation. Expression of ARF8 is controlled by miR167.	773	1	QQQQQQQ	7	100	7	1	483	489	62	DPLRQQFVQLQEPHHQYLQQSASHNSDLML	ASRHLMHAQTQIMSENLPQQNMRQEVSNQP	GO:0005634:nucleus;GO:0005874:microtubule;	GO:0006350:transcription;GO:0006355:regulation of transcription, DNA-dependent;GO:0007017:microtubule-based process;GO:0009725:response to hormone stimulus;GO:0009733:response to auxin stimulus;GO:0009734:auxin mediated signaling pathway;GO:0009908:flower development;GO:0045449:regulation of transcription;	GO:0003677:DNA binding;GO:0003700:sequence-specific DNA binding transcription factor activity;GO:0005525:GTP binding;GO:0046983:protein dimerization activity;	---
>prot|EG:AT4G38810.2-P|cod|AT4G38810.2-TAIR|gene|AT4G38810-TAIR-G|ann|calcium-binding EF hand family protein; calcium-binding EF hand family protein; FUNCTIONS IN: calcium ion binding; LOCATED IN: cellular_component unknown; EXPRESSED IN: 23 plant structures; EXPRESSED DURING: 13 growth stages; CONTAINS InterPro DOMAIN/s: EF-HAND 1 (InterPro:IPR018247), EF-HAND 2 (InterPro:IPR018249), Calcium-binding EF-hand (InterPro:IPR002048); BEST Arabidopsis thaliana protein match is: calcium-binding EF hand family protein (TAIR:AT5G28830.1); Has 189 Blast hits to 127 proteins in 14 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 186; Viruses - 0; Other Eukaryotes - 3 (source: NCBI BLink).	375	1	QQQQQ	5	100	5	1	9	13	2	MDLKSNNHQQQQQVLDGSDIVELVENEKVF	VLDGSDIVELVENEKVFDKFVEQKFQQLDQ	GO:0005575:cellular_component;GO:0005694:chromosome;	GO:0006259:DNA metabolic process;	GO:0003677:DNA binding;GO:0003824:catalytic activity;GO:0005509:calcium ion binding;GO:0005524:ATP binding;	---
>prot|EG:AT1G75410.2-P|cod|AT1G75410.2-TAIR|gene|AT1G75410-TAIR-G|ann|BLH3 (BEL1-LIKE HOMEODOMAIN 3); DNA binding / transcription factor; BEL1-like homeodomain 3 (BLH3)	524	1	QQQQQQQ	7	100	7	1	24	30	4	MAVYYPNSVGMQSLYQESIYLNEQQQQQQQ	ASSSSAASFSEIVSGDVRNNEMVFIPPTSD	GO:0005634:nucleus;	GO:0006350:transcription;GO:0006355:regulation of transcription, DNA-dependent;GO:0045449:regulation of transcription;GO:0048510:regulation of timing of transition from vegetative to reproductive phase;	GO:0003677:DNA binding;GO:0003700:sequence-specific DNA binding transcription factor activity;GO:0005515:protein binding;GO:0030528:transcription regulator activity;GO:0043565:sequence-specific DNA binding;	---
>prot|EG:AT5G48800.1-P|cod|AT5G48800.1-TAIR|gene|AT5G48800-TAIR-G|ann|phototropic-responsive NPH3 family protein; phototropic-responsive NPH3 family protein; FUNCTIONS IN: protein binding, signal transducer activity; INVOLVED IN: response to light stimulus; LOCATED IN: plasma membrane; EXPRESSED IN: 18 plant structures; EXPRESSED DURING: 7 growth stages; CONTAINS InterPro DOMAIN/s: NPH3 (InterPro:IPR004249), BTB/POZ (InterPro:IPR013069), BTB/POZ fold (InterPro:IPR011333), BTB/POZ-like (InterPro:IPR000210); BEST Arabidopsis thaliana protein match is: phototropic-responsive NPH3 family protein (TAIR:AT1G03010.1); Has 442 Blast hits to 424 proteins in 15 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 442; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink).	614	1	QQQQQ	5	100	5	1	502	506	81	QSIVQVLYFEQLKLRSSLCSSYSDEEPKPK	SWRINSGALSATMSPKDNYASLRRENRELK	GO:0005886:plasma membrane;	GO:0009416:response to light stimulus;	GO:0004871:signal transducer activity;GO:0005515:protein binding;	---
>prot|EG:AT1G63520.1-P|cod|AT1G63520.1-TAIR|gene|AT1G63520-TAIR-G|ann|unknown protein; unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: cellular_component unknown; EXPRESSED IN: inflorescence meristem, hypocotyl, flower, root; EXPRESSED DURING: petal differentiation and expansion stage; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT4G11450.1); Has 63 Blast hits to 63 proteins in 5 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 63; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink).	528	1	QQQQQQ	6	100	6	1	93	98	17	RRKISDAEKFSVEQYSSGGFFGVRLNTNGR	RLAKPLVTERNMEPRLQKSLSARMQFPFMP	GO:0005575:cellular_component;	GO:0008150:biological_process;	GO:0003674:molecular_function;	---
>prot|EG:AT5G19090.1-P|cod|AT5G19090.1-TAIR|gene|AT5G19090-TAIR-G|ann|heavy-metal-associated domain-containing protein; heavy-metal-associated domain-containing protein; FUNCTIONS IN: metal ion binding; INVOLVED IN: metal ion transport; LOCATED IN: cellular_component unknown; EXPRESSED IN: 22 plant structures; EXPRESSED DURING: 13 growth stages; CONTAINS InterPro DOMAIN/s: Heavy metal transport/detoxification protein (InterPro:IPR006121); BEST Arabidopsis thaliana protein match is: heavy-metal-associated domain-containing protein (TAIR:AT3G06130.1); Has 174112 Blast hits to 47721 proteins in 1906 species: Archae - 322; Bacteria - 36869; Metazoa - 74445; Fungi - 11471; Plants - 19768; Viruses - 2637; Other Eukaryotes - 28600 (source: NCBI BLink).	587	1	QQQQQQQQQQ	10	100	10	1	501	510	85	SAEAPPGYFQGQVSGNGGGGQDSMPGNPYL	YLAAVMNQQRSMGNERFQPMMYARPPPAVN	GO:0005575:cellular_component;GO:0016020:membrane;	GO:0030001:metal ion transport;GO:0051260:protein homooligomerization;	GO:0046872:metal ion binding;	---
>prot|EG:AT5G57100.1-P|cod|AT5G57100.1-TAIR|gene|AT5G57100-TAIR-G|ann|transporter-related; transporter-related; LOCATED IN: membrane; EXPRESSED IN: 23 plant structures; EXPRESSED DURING: 13 growth stages; CONTAINS InterPro DOMAIN/s: Protein of unknown function DUF250 (InterPro:IPR004853); BEST Arabidopsis thaliana protein match is: transporter-related (TAIR:AT5G55950.1); Has 1445 Blast hits to 1442 proteins in 171 species: Archae - 0; Bacteria - 6; Metazoa - 447; Fungi - 255; Plants - 558; Viruses - 0; Other Eukaryotes - 179 (source: NCBI BLink).	390	1	QQQQQ	5	100	5	1	54	58	13	DSDAGERGKALEDLRASLFNRFRSPETPKR	HRICGPTVALTFNFVVAISIIFMNKWVLKN	GO:0016020:membrane;GO:0016021:integral to membrane;	---	---	---
>prot|EG:AT1G69280.1-P|cod|AT1G69280.1-TAIR|gene|AT1G69280-TAIR-G|ann|unknown protein; unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: cellular_component unknown; EXPRESSED IN: male gametophyte, pollen tube; EXPRESSED DURING: L mature pollen stage, M germinated pollen stage; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT2G03630.1); Has 963 Blast hits to 496 proteins in 33 species: Archae - 0; Bacteria - 4; Metazoa - 849; Fungi - 9; Plants - 40; Viruses - 0; Other Eukaryotes - 61 (source: NCBI BLink).	400	1	QQQQQQKQ	8	87.5	6	0.75	289	296	72	DETPSSTQSFSYPITKKKKKKKKATKKKMT	KKRCSWLCCKNTGPCFSCCRLPSCGYNFFC	GO:0005575:cellular_component;	GO:0008150:biological_process;	GO:0003674:molecular_function;	---
>prot|EG:AT2G26490.1-P|cod|AT2G26490.1-TAIR|gene|AT2G26490-TAIR-G|ann|transducin family protein / WD-40 repeat family protein; transducin family protein / WD-40 repeat family protein; FUNCTIONS IN: nucleotide binding; INVOLVED IN: biological_process unknown; LOCATED IN: heterotrimeric G-protein complex; EXPRESSED IN: 6 plant structures; EXPRESSED DURING: L mature pollen stage, M germinated pollen stage, 4 anthesis, petal differentiation and expansion stage; CONTAINS InterPro DOMAIN/s: WD40 repeat-like (InterPro:IPR011046), WD40 repeat, region (InterPro:IPR017986), WD40/YVTN repeat-like (InterPro:IPR015943), WD40 repeat (InterPro:IPR001680); BEST Arabidopsis thaliana protein match is: transducin family protein / WD-40 repeat family protein (TAIR:AT4G34380.1); Has 28170 Blast hits to 14028 proteins in 472 species: Archae - 22; Bacteria - 3610; Metazoa - 12467; Fungi - 5731; Plants - 2382; Viruses - 0; Other Eukaryotes - 3958 (source: NCBI BLink).	465	1	QQQQQQ	6	100	6	1	432	437	92	WIVYSGSLDKSVKVWGVSESFIDMNQMSMM	HVISHSEPFMSDGSFSSSAGGASSHRRH	GO:0005834:heterotrimeric G-protein complex;	GO:0008150:biological_process;	GO:0000166:nucleotide binding;	---
>prot|EG:AT2G47260.1-P|cod|AT2G47260.1-TAIR|gene|AT2G47260-TAIR-G|ann|WRKY23; transcription factor; member of WRKY Transcription Factor; Group I	337	1	QQQQQ	5	100	5	1	282	286	83	SSLGNGCFGFPIDGSTLISPQFQQLVQYHH	ELMSCFGGVNEYLNSHANEYGDDNRVKKSR	GO:0005634:nucleus;	GO:0006350:transcription;GO:0006355:regulation of transcription, DNA-dependent;GO:0045449:regulation of transcription;	GO:0003677:DNA binding;GO:0003700:sequence-specific DNA binding transcription factor activity;GO:0043565:sequence-specific DNA binding;	---
>prot|EG:AT5G62790.1-P|cod|AT5G62790.1-TAIR|gene|AT5G62790-TAIR-G|ann|DXR (1-DEOXY-D-XYLULOSE 5-PHOSPHATE REDUCTOISOMERASE); 1-deoxy-D-xylulose-5-phosphate reductoisomerase; 1-Deoxy-d-xylulose 5-phosphate reductoisomerase (DXR) catalyzes the first committed step of the 2-C-methyl-d-erythritol 4-phosphate pathway for isoprenoid biosynthesis. In Arabidopsis, DXR is encoded by a single-copy gene. Arabidopsis DXR is targeted to plastids and localizes into chloroplasts of leaf cells. DXR knockout or strongly silenced lines have a seedling lethal, albino phenotype. Transgenic, partially silenced lines expressing 35S:DXR have a variegated phenotype.	477	1	QQQQQ	5	100	5	1	55	59	11	PIPKLSGGFSLRRRNQGRGFGKGVKCSVKV	PPPAWPGRAVPEAPRQSWDGPKPISIVGST	GO:0009507:chloroplast;GO:0009536:plastid;GO:0009570:chloroplast stroma;	GO:0008152:metabolic process;GO:0008299:isoprenoid biosynthetic process;GO:0019288:isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway;GO:0046686:response to cadmium ion;GO:0055114:oxidation reduction;	GO:0003824:catalytic activity;GO:0005488:binding;GO:0016491:oxidoreductase activity;GO:0030604:1-deoxy-D-xylulose-5-phosphate reductoisomerase activity;GO:0046872:metal ion binding;	---
>prot|EG:AT1G72390.1-P|cod|AT1G72390.1-TAIR|gene|AT1G72390-TAIR-G|ann|unknown protein; unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: cellular_component unknown; EXPRESSED IN: 23 plant structures; EXPRESSED DURING: 13 growth stages; Has 7899 Blast hits to 6384 proteins in 374 species: Archae - 6; Bacteria - 210; Metazoa - 3913; Fungi - 1320; Plants - 701; Viruses - 22; Other Eukaryotes - 1727 (source: NCBI BLink).	1325	3	QQQQQ	5	100	5	1	983	987	74	SAINSMSQSSGMQPGGQMANKYSPLQLQML	AAVQKKIMMGLGSGVGMGMGMGMGMGMGSM	GO:0005575:cellular_component;	GO:0008150:biological_process;GO:0009405:pathogenesis;	GO:0003674:molecular_function;	---
>prot|EG:AT1G72390.1-P|cod|AT1G72390.1-TAIR|gene|AT1G72390-TAIR-G|ann|unknown protein; unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: cellular_component unknown; EXPRESSED IN: 23 plant structures; EXPRESSED DURING: 13 growth stages; Has 7899 Blast hits to 6384 proteins in 374 species: Archae - 6; Bacteria - 210; Metazoa - 3913; Fungi - 1320; Plants - 701; Viruses - 22; Other Eukaryotes - 1727 (source: NCBI BLink).	1325	3	QQQQQQQLQQQPQQQQLQHQQQLQQ	25	80	7	0.28	1160	1184	87	QNRANLQRAAAMGNMGPPKLMPGMMNLYMN	PMSQPSQQLAQSPQQQQQLQQHEQPQQAQQ	GO:0005575:cellular_component;	GO:0008150:biological_process;GO:0009405:pathogenesis;	GO:0003674:molecular_function;	---
>prot|EG:AT1G72390.1-P|cod|AT1G72390.1-TAIR|gene|AT1G72390-TAIR-G|ann|unknown protein; unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: cellular_component unknown; EXPRESSED IN: 23 plant structures; EXPRESSED DURING: 13 growth stages; Has 7899 Blast hits to 6384 proteins in 374 species: Archae - 6; Bacteria - 210; Metazoa - 3913; Fungi - 1320; Plants - 701; Viruses - 22; Other Eukaryotes - 1727 (source: NCBI BLink).	1325	3	QQQQQLQQHEQPQQAQQQQQ	20	75	5	0.25	1198	1217	90	QQQPQQQQLQHQQQLQQPMSQPSQQLAQSP	ATASPLQSVLSPPQVGSPSAGITQQQLQQS	GO:0005575:cellular_component;	GO:0008150:biological_process;GO:0009405:pathogenesis;	GO:0003674:molecular_function;	---
>prot|EG:AT5G61270.1-P|cod|AT5G61270.1-TAIR|gene|AT5G61270-TAIR-G|ann|PIF7 (PHYTOCHROME-INTERACTING FACTOR7); DNA binding / double-stranded DNA binding / transcription factor; Basic helix-loop-helix (bHLH) phytochrome interacting factor. Interacts specifically with the far-red light–absorbing Pfr form of phyB through a conserved domain called the active phyB binding motif. Upon light exposure, PIF7 rapidly migrates to intranuclear speckles, where it colocalizes with phyB. Role as negative regulator of phyB-mediated seedling deetiolation.	366	1	QHQQQQQQQQQQQQQQQQQFQ	21	90.4761904761905	17	0.80952380952381	247	267	67	AQVQFMSLRANLPQQMMIPQLPPPQSVLSI	MSLLATMARMGMGGGGNGYGGLVPPPPPPP	GO:0005575:cellular_component;GO:0005634:nucleus;GO:0016607:nuclear speck;	GO:0006350:transcription;GO:0006414:translational elongation;GO:0009416:response to light stimulus;GO:0009585:red, far-red light phototransduction;GO:0009704:de-etiolation;GO:0010017:red or far-red light signaling pathway;GO:0045449:regulation of transcription;	GO:0003677:DNA binding;GO:0003690:double-stranded DNA binding;GO:0003700:sequence-specific DNA binding transcription factor activity;GO:0030528:transcription regulator activity;GO:0030533:triplet codon-amino acid adaptor activity;	---
>prot|EG:AT1G29370.1-P|cod|AT1G29370.1-TAIR|gene|AT1G29370-TAIR-G|ann|kinase-related; kinase-related; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: cellular_component unknown; EXPRESSED IN: guard cell; CONTAINS InterPro DOMAIN/s: Protein of unknown function DUF1296 (InterPro:IPR009719); BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT1G29350.1); Has 13654 Blast hits to 7528 proteins in 391 species: Archae - 0; Bacteria - 391; Metazoa - 5624; Fungi - 1558; Plants - 888; Viruses - 71; Other Eukaryotes - 5122 (source: NCBI BLink).	831	1	QQQQQQQQHQQQ	12	91.6666666666667	8	0.666666666666667	712	723	85	LNQQSATTGTTLGYDDVLSSQYKENHLLAL	NENSAMWHQGHGSRTMSGVPTNTYYNLQAQ	GO:0005575:cellular_component;	GO:0008150:biological_process;	GO:0003674:molecular_function;	---
>prot|EG:AT5G56120.1-P|cod|AT5G56120.1-TAIR|gene|AT5G56120-TAIR-G|ann|unknown protein; unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: cellular_component unknown; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT3G12870.1); Has 51 Blast hits to 51 proteins in 6 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 51; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink).	236	1	QQQQQ	5	100	5	1	22	26	9	MAGTKDSHVVEIPVDEEHKERQQQQQLVAV	LVAVSNPGMGILKVIQQHPLSEISESPGHL	GO:0000786:nucleosome;GO:0005575:cellular_component;GO:0005634:nucleus;	GO:0006334:nucleosome assembly;GO:0008150:biological_process;	GO:0003674:molecular_function;GO:0003677:DNA binding;	---
>prot|EG:AT5G19900.1-P|cod|AT5G19900.1-TAIR|gene|AT5G19900-TAIR-G|ann|PRLI-interacting factor, putative; PRLI-interacting factor, putative; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: chloroplast; EXPRESSED IN: 24 plant structures; EXPRESSED DURING: 15 growth stages; Has 1528 Blast hits to 1237 proteins in 215 species: Archae - 5; Bacteria - 69; Metazoa - 541; Fungi - 137; Plants - 125; Viruses - 37; Other Eukaryotes - 614 (source: NCBI BLink).	494	1	QQQQQ	5	100	5	1	118	122	23	NLAPNNFGSKMSRNNWKGKKITSDKRPMME	IRRMHNSGIPMYNPQQLPGSGSIQVGAGGY	GO:0009507:chloroplast;	GO:0008150:biological_process;	GO:0003674:molecular_function;	---
>prot|EG:AT2G36400.1-P|cod|AT2G36400.1-TAIR|gene|AT2G36400-TAIR-G|ann|AtGRF3 (GROWTH-REGULATING FACTOR 3); transcription activator; Growth regulating factor encoding transcription activator. One of the nine members of a GRF gene family, containing nuclear targeting domain. Mutants result in smaller leaves indicating the role of the gene in leaf development. Expressed in root, shoot and flower.	398	1	QQQQQHQ	7	85.7142857142857	5	0.714285714285714	11	17	2	MDLQLKQWRSQQQQQHQTESEEQPSAAKIP	TESEEQPSAAKIPKHVFDQIHSHTATSTAL	GO:0005634:nucleus;GO:0016021:integral to membrane;	GO:0007186:G-protein coupled receptor protein signaling pathway;GO:0045449:regulation of transcription;GO:0048366:leaf development;	GO:0005524:ATP binding;GO:0016494:C-X-C chemokine receptor activity;GO:0016563:transcription activator activity;GO:0016818:hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides;	---
>prot|EG:AT3G24350.1-P|cod|AT3G24350.1-TAIR|gene|AT3G24350-TAIR-G|ann|SYP32 (SYNTAXIN OF PLANTS 32); SNAP receptor; member of Glycoside Hydrolase Family 17	347	1	QQSQQQQQQQQQQ	13	92.3076923076923	10	0.769230769230769	237	249	68	VPLPWANGSSSSSSQLVPWKPGEGESSPLL	MVPLQDTYMQGRAEALHTVESTIHELSSIF	GO:0005794:Golgi apparatus;GO:0016020:membrane;GO:0016021:integral to membrane;	GO:0006810:transport;GO:0006886:intracellular protein transport;GO:0006944:cellular membrane fusion;GO:0015031:protein transport;GO:0016192:vesicle-mediated transport;	GO:0005484:SNAP receptor activity;GO:0005515:protein binding;	---
>prot|EG:AT3G13810.1-P|cod|AT3G13810.1-TAIR|gene|AT3G13810-TAIR-G|ann|AtIDD11 (Arabidopsis thaliana Indeterminate(ID)-Domain 11); nucleic acid binding / transcription factor/ zinc ion binding; Arabidopsis thaliana Indeterminate(ID)-Domain 11 (AtIDD11); FUNCTIONS IN: transcription factor activity, zinc ion binding, nucleic acid binding; INVOLVED IN: regulation of transcription; LOCATED IN: intracellular; EXPRESSED IN: 20 plant structures; EXPRESSED DURING: 9 growth stages; CONTAINS InterPro DOMAIN/s: Zinc finger, C2H2-like (InterPro:IPR015880), Zinc finger, C2H2-type (InterPro:IPR007087); BEST Arabidopsis thaliana protein match is: AtIDD7 (Arabidopsis thaliana Indeterminate(ID)-Domain 7); nucleic acid binding / transcription factor/ zinc ion binding (TAIR:AT1G55110.1); Has 46742 Blast hits to 18955 proteins in 244 species: Archae - 0; Bacteria - 8; Metazoa - 41855; Fungi - 293; Plants - 408; Viruses - 0; Other Eukaryotes - 4178 (source: NCBI BLink).	513	1	QQQQEQQQQQ	10	90	5	0.5	51	60	9	SNLTSASGDQASVSSGNITEASGSNYFPHH	LVVPDSQTQKKRRNQPGNPDPESEVIALSP	GO:0005622:intracellular;	GO:0045449:regulation of transcription;	GO:0003676:nucleic acid binding;GO:0003700:sequence-specific DNA binding transcription factor activity;GO:0008270:zinc ion binding;	---
>prot|EG:AT5G19790.1-P|cod|AT5G19790.1-TAIR|gene|AT5G19790-TAIR-G|ann|RAP2.11 (related to AP2 11); DNA binding / transcription factor; encodes a member of the ERF (ethylene response factor) subfamily B-6 of ERF/AP2 transcription factor family (RAP2.11). The protein contains one AP2 domain. There are 12 members in this subfamily including RAP2.11.	253	1	QQQQQQ	6	100	6	1	103	108	40	TRTNFANHFPNNSQLSLKIRNLLHQKQSMK	HKPVSSLTDCNINYISTATSLTTTTTTTTT	GO:0005634:nucleus;	GO:0006350:transcription;GO:0006355:regulation of transcription, DNA-dependent;GO:0009873:ethylene mediated signaling pathway;GO:0045449:regulation of transcription;	GO:0003677:DNA binding;GO:0003700:sequence-specific DNA binding transcription factor activity;	---
>prot|EG:AT1G78260.2-P|cod|AT1G78260.2-TAIR|gene|AT1G78260-TAIR-G|ann|RNA recognition motif (RRM)-containing protein; RNA recognition motif (RRM)-containing protein; FUNCTIONS IN: RNA binding, nucleotide binding, nucleic acid binding; INVOLVED IN: biological_process unknown; LOCATED IN: cellular_component unknown; EXPRESSED IN: 21 plant structures; EXPRESSED DURING: 11 growth stages; CONTAINS InterPro DOMAIN/s: RNA recognition motif, RNP-1 (InterPro:IPR000504), Nucleotide-binding, alpha-beta plait (InterPro:IPR012677); BEST Arabidopsis thaliana protein match is: RNA binding / nucleic acid binding / nucleotide binding (TAIR:AT1G22330.1); Has 14940 Blast hits to 11778 proteins in 563 species: Archae - 2; Bacteria - 773; Metazoa - 8589; Fungi - 1576; Plants - 2603; Viruses - 0; Other Eukaryotes - 1397 (source: NCBI BLink).	271	1	QQQQQ	5	100	5	1	169	173	62	YPSYGYTYNPDQFGYHQALYNTQLQQAQYY	LYGGGATSPSSSGATIMPSPYYYGYSLQAP	GO:0005575:cellular_component;	GO:0008150:biological_process;	GO:0000166:nucleotide binding;GO:0003676:nucleic acid binding;GO:0003723:RNA binding;	---
>prot|EG:AT4G17950.1-P|cod|AT4G17950.1-TAIR|gene|AT4G17950-TAIR-G|ann|DNA-binding family protein; DNA-binding family protein; FUNCTIONS IN: DNA binding; INVOLVED IN: regulation of transcription, DNA-dependent; LOCATED IN: nucleus; EXPRESSED IN: 16 plant structures; EXPRESSED DURING: 11 growth stages; CONTAINS InterPro DOMAIN/s: Protein of unknown function DUF296 (InterPro:IPR005175), AT hook, DNA-binding, conserved site (InterPro:IPR017956); BEST Arabidopsis thaliana protein match is: DNA-binding family protein (TAIR:AT5G46640.1); Has 25892 Blast hits to 11638 proteins in 527 species: Archae - 0; Bacteria - 1043; Metazoa - 9664; Fungi - 2922; Plants - 1204; Viruses - 47; Other Eukaryotes - 11012 (source: NCBI BLink).	439	1	QQQQQQQQQQQQQQQQQHLQQQQQ	24	91.6666666666667	17	0.708333333333333	9	32	2	MDSREIHHQQQQQQQQQQQQQQQQQHLQQQ	PPPGMLMSHHNSYNRNPNAAAAVLMGHNTS	GO:0005634:nucleus;GO:0016021:integral to membrane;	GO:0006355:regulation of transcription, DNA-dependent;GO:0007186:G-protein coupled receptor protein signaling pathway;	GO:0003677:DNA binding;GO:0004957:prostaglandin E receptor activity;	---
>prot|EG:AT5G65540.1-P|cod|AT5G65540.1-TAIR|gene|AT5G65540-TAIR-G|ann|unknown protein; unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: cellular_component unknown; EXPRESSED IN: 22 plant structures; EXPRESSED DURING: 13 growth stages; Has 7021 Blast hits to 3682 proteins in 251 species: Archae - 0; Bacteria - 162; Metazoa - 2380; Fungi - 717; Plants - 744; Viruses - 57; Other Eukaryotes - 2961 (source: NCBI BLink).	605	1	QNFQQQQQ	8	75	5	0.625	467	474	77	QLHLQQQASLRLPQQIQRQMHPQMQQMVNP	LERMRRRPVTSPRPNMDMEKDRPLVQVKLE	GO:0005575:cellular_component;	GO:0008150:biological_process;	GO:0003674:molecular_function;	---
>prot|EG:AT1G74720.1-P|cod|AT1G74720.1-TAIR|gene|AT1G74720-TAIR-G|ann|C2 domain-containing protein; C2 domain-containing protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: plasma membrane; EXPRESSED IN: 22 plant structures; EXPRESSED DURING: 13 growth stages; CONTAINS InterPro DOMAIN/s: C2 membrane targeting protein (InterPro:IPR018029), C2 calcium/lipid-binding region, CaLB (InterPro:IPR008973), Phosphoribosyltransferase C-terminal, plant (InterPro:IPR013583), C2 calcium-dependent membrane targeting (InterPro:IPR000008); BEST Arabidopsis thaliana protein match is: C2 domain-containing protein (TAIR:AT5G17980.1); Has 5335 Blast hits to 4284 proteins in 306 species: Archae - 2; Bacteria - 102; Metazoa - 2796; Fungi - 545; Plants - 891; Viruses - 32; Other Eukaryotes - 967 (source: NCBI BLink).	1081	1	QQQQQQQQQ	9	100	9	1	162	170	14	VFSWIRGEIGLKIYYYDEAADEDTAGGGGG	FHPPQQEADEQQHQQQFHPPPQQMMNIPPE	GO:0005886:plasma membrane;	GO:0008150:biological_process;	GO:0003674:molecular_function;GO:0016740:transferase activity;	---
>prot|EG:AT1G58420.1-P|cod|AT1G58420.1-TAIR|gene|AT1G58420-TAIR-G|ann|unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: cellular_component unknown; EXPRESSED IN: 21 plant structures; EXPRESSED DURING: 11 growth stages; CONTAINS InterPro DOMAIN/s: Uncharacterised conserved protein UCP031279 (InterPro:IPR016972); BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT1G10140.1); Has 28 Blast hits to 28 proteins in 6 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 28; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink).	179	1	QQQQQQQQQRQ	11	90.9090909090909	9	0.818181818181818	105	115	58	DFTFDDDYSELLRAASVRSLGHKNEIDMII	ENRVAMGAVTVKGGLPKSSSVGMTMARIDE	GO:0005575:cellular_component;	GO:0008150:biological_process;	GO:0003674:molecular_function;	---
>prot|EG:AT3G47620.1-P|cod|AT3G47620.1-TAIR|gene|AT3G47620-TAIR-G|ann|AtTCP14 (TEOSINTE BRANCHED1, CYCLOIDEA and PCF (TCP) 14); transcription factor; Encodes a transcription factor AtTCP14 that regulates seed germination. AtTCP14 shows elevated expression level just prior to germination. AtTCP14 is predominantly expressed in the vascular tissue of the embryo, and affects gene expression in radicles in a non-cell-autonomous manner.	489	2	QQQQQQQ	7	100	7	1	220	226	44	SSGSSMSLPSHFRSAASTFSPNNIFSPAML	RGGGVGFHHPHLQGRAPTSSLFPGIDNFTP	GO:0005575:cellular_component;GO:0005634:nucleus;	GO:0006350:transcription;GO:0009737:response to abscisic acid stimulus;GO:0009739:response to gibberellin stimulus;GO:0010029:regulation of seed germination;GO:0045449:regulation of transcription;	GO:0003677:DNA binding;GO:0003700:sequence-specific DNA binding transcription factor activity;	---
>prot|EG:AT3G47620.1-P|cod|AT3G47620.1-TAIR|gene|AT3G47620-TAIR-G|ann|AtTCP14 (TEOSINTE BRANCHED1, CYCLOIDEA and PCF (TCP) 14); transcription factor; Encodes a transcription factor AtTCP14 that regulates seed germination. AtTCP14 shows elevated expression level just prior to germination. AtTCP14 is predominantly expressed in the vascular tissue of the embryo, and affects gene expression in radicles in a non-cell-autonomous manner.	489	2	QQQQQHQ	7	85.7142857142857	5	0.714285714285714	294	300	60	HNPTKQEGDQDSEELNSEKKRRIQTTSDLH	HDQIGGYTLQSSNSGSTATAAAAQQIPGNF	GO:0005575:cellular_component;GO:0005634:nucleus;	GO:0006350:transcription;GO:0009737:response to abscisic acid stimulus;GO:0009739:response to gibberellin stimulus;GO:0010029:regulation of seed germination;GO:0045449:regulation of transcription;	GO:0003677:DNA binding;GO:0003700:sequence-specific DNA binding transcription factor activity;	---
>prot|EG:AT3G18230.1-P|cod|AT3G18230.1-TAIR|gene|AT3G18230-TAIR-G|ann|octicosapeptide/Phox/Bem1p (PB1) domain-containing protein; octicosapeptide/Phox/Bem1p (PB1) domain-containing protein; LOCATED IN: cytosol, nucleus; EXPRESSED IN: 24 plant structures; EXPRESSED DURING: 13 growth stages; CONTAINS InterPro DOMAIN/s: Octicosapeptide/Phox/Bem1p (InterPro:IPR000270); BEST Arabidopsis thaliana protein match is: octicosapeptide/Phox/Bem1p (PB1) domain-containing protein (TAIR:AT2G01190.1); Has 2870 Blast hits to 2394 proteins in 241 species: Archae - 2; Bacteria - 93; Metazoa - 1285; Fungi - 484; Plants - 401; Viruses - 8; Other Eukaryotes - 597 (source: NCBI BLink).	666	1	QQQQQ	5	100	5	1	473	477	71	SSQVLPQTENTSAQTTSHVLSQPGTYTTMD	PLAQQPFLHQGVQYIPHPSQYIPIYSHQQQ	GO:0005634:nucleus;GO:0005829:cytosol;	---	---	---
>prot|EG:AT2G18300.1-P|cod|AT2G18300.1-TAIR|gene|AT2G18300-TAIR-G|ann|basic helix-loop-helix (bHLH) family protein; basic helix-loop-helix (bHLH) family protein; FUNCTIONS IN: transcription factor activity; INVOLVED IN: response to cytokinin stimulus, regulation of transcription; LOCATED IN: nucleus; EXPRESSED IN: 13 plant structures; EXPRESSED DURING: 8 growth stages; CONTAINS InterPro DOMAIN/s: Basic helix-loop-helix dimerisation region bHLH (InterPro:IPR001092), Helix-loop-helix DNA-binding (InterPro:IPR011598); BEST Arabidopsis thaliana protein match is: BEE2 (BR Enhanced Expression 2); DNA binding / transcription factor (TAIR:AT4G36540.1); Has 1167 Blast hits to 1167 proteins in 92 species: Archae - 0; Bacteria - 0; Metazoa - 59; Fungi - 32; Plants - 1058; Viruses - 0; Other Eukaryotes - 18 (source: NCBI BLink).	335	1	QQQQQQLQQ	9	88.8888888888889	6	0.666666666666667	28	36	8	MLEGLVSQESLSLNSMDMSVLERLKWVQQQ	VVSHSSNNSPELLQILQFHGSNNDELLESS	GO:0005634:nucleus;	GO:0006350:transcription;GO:0009735:response to cytokinin stimulus;GO:0045449:regulation of transcription;	GO:0003677:DNA binding;GO:0003700:sequence-specific DNA binding transcription factor activity;GO:0030528:transcription regulator activity;	---
>prot|EG:AT1G77960.1-P|cod|AT1G77960.1-TAIR|gene|AT1G77960-TAIR-G|ann|unknown protein; unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: cellular_component unknown; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT1G28630.4); Has 13344 Blast hits to 6583 proteins in 344 species: Archae - 0; Bacteria - 351; Metazoa - 4828; Fungi - 1258; Plants - 360; Viruses - 46; Other Eukaryotes - 6501 (source: NCBI BLink).	420	1	QQQQQQQ	7	100	7	1	126	132	30	HQNQNQHQHQHQYQNQHQHQYQNQHQHRVV	LINSHETWLQDKLSNMLNTIQQESSVFTRN	GO:0005575:cellular_component;	GO:0008150:biological_process;	GO:0003674:molecular_function;	---
>prot|EG:AT2G45810.1-P|cod|AT2G45810.1-TAIR|gene|AT2G45810-TAIR-G|ann|DEAD/DEAH box helicase, putative; DEAD/DEAH box helicase, putative; FUNCTIONS IN: helicase activity, ATP-dependent helicase activity, nucleic acid binding, ATP binding; LOCATED IN: cellular_component unknown; EXPRESSED IN: 23 plant structures; EXPRESSED DURING: 13 growth stages; CONTAINS InterPro DOMAIN/s: RNA helicase, DEAD-box type, Q motif (InterPro:IPR014014), DNA/RNA helicase, DEAD/DEAH box type, N-terminal (InterPro:IPR011545), RNA helicase, ATP-dependent, DEAD-box, conserved site (InterPro:IPR000629), DEAD-like helicase, N-terminal (InterPro:IPR014001), DNA/RNA helicase, C-terminal (InterPro:IPR001650), Helicase, superfamily 1 and 2, ATP-binding (InterPro:IPR014021); BEST Arabidopsis thaliana protein match is: DEAD/DEAH box helicase, putative (RH12) (TAIR:AT3G61240.2); Has 52931 Blast hits to 37964 proteins in 1941 species: Archae - 402; Bacteria - 12184; Metazoa - 13805; Fungi - 6217; Plants - 2991; Viruses - 299; Other Eukaryotes - 17033 (source: NCBI BLink).	528	1	QQIQQQQQLQQQQQQQQQQQEQQ	23	86.9565217391304	11	0.478260869565217	74	96	14	TPFPQQPQPQPPQYLQSQSDAQQYVQRGYP	WSRRAQLPGDPSYIDEVEKTVQSEAISDSN	GO:0000932:cytoplasmic mRNA processing body;GO:0005575:cellular_component;GO:0005737:cytoplasm;	GO:0006397:mRNA processing;GO:0006414:translational elongation;GO:0006417:regulation of translation;GO:0006810:transport;GO:0051028:mRNA transport;	GO:0000166:nucleotide binding;GO:0003676:nucleic acid binding;GO:0003723:RNA binding;GO:0004386:helicase activity;GO:0005524:ATP binding;GO:0008026:ATP-dependent helicase activity;GO:0016787:hydrolase activity;GO:0030533:triplet codon-amino acid adaptor activity;	---
>prot|EG:AT1G55080.1-P|cod|AT1G55080.1-TAIR|gene|AT1G55080-TAIR-G|ann|unknown protein; unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: cellular_component unknown; EXPRESSED IN: 17 plant structures; EXPRESSED DURING: 8 growth stages; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT1G29580.1); Has 64498 Blast hits to 23302 proteins in 980 species: Archae - 12; Bacteria - 3118; Metazoa - 24455; Fungi - 7046; Plants - 5363; Viruses - 296; Other Eukaryotes - 24208 (source: NCBI BLink).	244	2	QQLFLQQQQLQQQQQQQQQQQ	21	80.9523809523809	11	0.523809523809524	31	51	12	MDQFSGGGGNWSMIPNVQAQGNFGTPTNHD	FHLQQQQQTQQQQQQFQPQQQQEMQQYQQF	GO:0005575:cellular_component;	GO:0008150:biological_process;	GO:0003674:molecular_function;	---
>prot|EG:AT1G55080.1-P|cod|AT1G55080.1-TAIR|gene|AT1G55080-TAIR-G|ann|unknown protein; unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: cellular_component unknown; EXPRESSED IN: 17 plant structures; EXPRESSED DURING: 8 growth stages; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT1G29580.1); Has 64498 Blast hits to 23302 proteins in 980 species: Archae - 12; Bacteria - 3118; Metazoa - 24455; Fungi - 7046; Plants - 5363; Viruses - 296; Other Eukaryotes - 24208 (source: NCBI BLink).	244	2	QQQQQLVQ	8	75	5	0.625	131	138	53	QSPPLQPQSLQSPPPQQTMVHTPQSMMHTP	TPVQTPQQHQSLASHFHLYPMVEKLADVIE	GO:0005575:cellular_component;	GO:0008150:biological_process;	GO:0003674:molecular_function;	---
>prot|EG:AT2G41900.1-P|cod|AT2G41900.1-TAIR|gene|AT2G41900-TAIR-G|ann|zinc finger (CCCH-type) family protein; zinc finger (CCCH-type) family protein; FUNCTIONS IN: transcription factor activity, nucleic acid binding; INVOLVED IN: regulation of transcription; EXPRESSED IN: 22 plant structures; EXPRESSED DURING: 13 growth stages; CONTAINS InterPro DOMAIN/s: Zinc finger, CCCH-type (InterPro:IPR000571), Ankyrin (InterPro:IPR002110); BEST Arabidopsis thaliana protein match is: zinc finger (CCCH-type) family protein (TAIR:AT5G12850.1); Has 4817 Blast hits to 2898 proteins in 270 species: Archae - 2; Bacteria - 179; Metazoa - 2413; Fungi - 222; Plants - 261; Viruses - 8; Other Eukaryotes - 1732 (source: NCBI BLink).	716	2	QFQQQQQQQQ	10	90	8	0.8	520	529	72	SAEGSSSPRFTDSALASAVFSPTHKSAVFN	SMLSPINTSFSSPKSVDHSLFSGGGRMSPR	---	GO:0045449:regulation of transcription;	GO:0003676:nucleic acid binding;GO:0003677:DNA binding;GO:0003700:sequence-specific DNA binding transcription factor activity;GO:0008270:zinc ion binding;GO:0046872:metal ion binding;	---
>prot|EG:AT2G41900.1-P|cod|AT2G41900.1-TAIR|gene|AT2G41900-TAIR-G|ann|zinc finger (CCCH-type) family protein; zinc finger (CCCH-type) family protein; FUNCTIONS IN: transcription factor activity, nucleic acid binding; INVOLVED IN: regulation of transcription; EXPRESSED IN: 22 plant structures; EXPRESSED DURING: 13 growth stages; CONTAINS InterPro DOMAIN/s: Zinc finger, CCCH-type (InterPro:IPR000571), Ankyrin (InterPro:IPR002110); BEST Arabidopsis thaliana protein match is: zinc finger (CCCH-type) family protein (TAIR:AT5G12850.1); Has 4817 Blast hits to 2898 proteins in 270 species: Archae - 2; Bacteria - 179; Metazoa - 2413; Fungi - 222; Plants - 261; Viruses - 8; Other Eukaryotes - 1732 (source: NCBI BLink).	716	2	QCVKQQQQQQQQQQQQHQ	18	77.7777777777778	12	0.666666666666667	577	594	80	HSLFSGGGRMSPRNVVEPISPMSARVSMLA	FRSLSSRELRTNSSPIVGSPVNNNTWSSKW	---	GO:0045449:regulation of transcription;	GO:0003676:nucleic acid binding;GO:0003677:DNA binding;GO:0003700:sequence-specific DNA binding transcription factor activity;GO:0008270:zinc ion binding;GO:0046872:metal ion binding;	---
>prot|EG:AT2G15690.1-P|cod|AT2G15690.1-TAIR|gene|AT2G15690-TAIR-G|ann|pentatricopeptide (PPR) repeat-containing protein; pentatricopeptide (PPR) repeat-containing protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: cellular_component unknown; EXPRESSED IN: 23 plant structures; EXPRESSED DURING: 13 growth stages; CONTAINS InterPro DOMAIN/s: Pentatricopeptide repeat (InterPro:IPR002885); BEST Arabidopsis thaliana protein match is: pentatricopeptide (PPR) repeat-containing protein (TAIR:AT4G32450.1); Has 17113 Blast hits to 8427 proteins in 455 species: Archae - 2; Bacteria - 520; Metazoa - 2794; Fungi - 1180; Plants - 10468; Viruses - 37; Other Eukaryotes - 2112 (source: NCBI BLink).	579	1	QQQQQPQ	7	85.7142857142857	5	0.714285714285714	182	188	31	GGQRPQYGGPGNNYQNQNVQQSNQSQYYTP	PPRSSNQSPNQMNEVAPPPSVEEVMRLCQR	GO:0005575:cellular_component;	GO:0008150:biological_process;	GO:0003674:molecular_function;	---
>prot|EG:AT1G55110.1-P|cod|AT1G55110.1-TAIR|gene|AT1G55110-TAIR-G|ann|AtIDD7 (Arabidopsis thaliana Indeterminate(ID)-Domain 7); nucleic acid binding / transcription factor/ zinc ion binding; Arabidopsis thaliana Indeterminate(ID)-Domain 7 (AtIDD7); FUNCTIONS IN: transcription factor activity, zinc ion binding, nucleic acid binding; INVOLVED IN: regulation of transcription; LOCATED IN: intracellular; EXPRESSED IN: 22 plant structures; EXPRESSED DURING: 13 growth stages; CONTAINS InterPro DOMAIN/s: Zinc finger, C2H2-like (InterPro:IPR015880), Zinc finger, C2H2-type (InterPro:IPR007087); BEST Arabidopsis thaliana protein match is: AtIDD11 (Arabidopsis thaliana Indeterminate(ID)-Domain 11); nucleic acid binding / transcription factor/ zinc ion binding (TAIR:AT3G13810.1); Has 46239 Blast hits to 18094 proteins in 343 species: Archae - 0; Bacteria - 0; Metazoa - 44259; Fungi - 229; Plants - 435; Viruses - 0; Other Eukaryotes - 1316 (source: NCBI BLink).	455	2	QQQQQQ	6	100	6	1	11	16	2	MMMNRDILFHQQQQQQMEENMSNLTSASGD	MEENMSNLTSASGDQASVSSGNRTETSGSN	GO:0005622:intracellular;	GO:0045449:regulation of transcription;	GO:0003676:nucleic acid binding;GO:0003700:sequence-specific DNA binding transcription factor activity;GO:0008270:zinc ion binding;	---
>prot|EG:AT1G55110.1-P|cod|AT1G55110.1-TAIR|gene|AT1G55110-TAIR-G|ann|AtIDD7 (Arabidopsis thaliana Indeterminate(ID)-Domain 7); nucleic acid binding / transcription factor/ zinc ion binding; Arabidopsis thaliana Indeterminate(ID)-Domain 7 (AtIDD7); FUNCTIONS IN: transcription factor activity, zinc ion binding, nucleic acid binding; INVOLVED IN: regulation of transcription; LOCATED IN: intracellular; EXPRESSED IN: 22 plant structures; EXPRESSED DURING: 13 growth stages; CONTAINS InterPro DOMAIN/s: Zinc finger, C2H2-like (InterPro:IPR015880), Zinc finger, C2H2-type (InterPro:IPR007087); BEST Arabidopsis thaliana protein match is: AtIDD11 (Arabidopsis thaliana Indeterminate(ID)-Domain 11); nucleic acid binding / transcription factor/ zinc ion binding (TAIR:AT3G13810.1); Has 46239 Blast hits to 18094 proteins in 343 species: Archae - 0; Bacteria - 0; Metazoa - 44259; Fungi - 229; Plants - 435; Viruses - 0; Other Eukaryotes - 1316 (source: NCBI BLink).	455	2	QQQQQ	5	100	5	1	446	450	98	FLGLRSLMSHNEILSFANNLGNCLNTSATE	HSHQD	GO:0005622:intracellular;	GO:0045449:regulation of transcription;	GO:0003676:nucleic acid binding;GO:0003700:sequence-specific DNA binding transcription factor activity;GO:0008270:zinc ion binding;	---
>prot|EG:AT4G18150.1-P|cod|AT4G18150.1-TAIR|gene|AT4G18150-TAIR-G|ann|unknown protein; unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: cellular_component unknown; CONTAINS InterPro DOMAIN/s: Protein of unknown function DUF1296 (InterPro:IPR009719); BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT1G29350.1); Has 362 Blast hits to 295 proteins in 47 species: Archae - 0; Bacteria - 2; Metazoa - 209; Fungi - 11; Plants - 7; Viruses - 0; Other Eukaryotes - 133 (source: NCBI BLink).	758	1	QQQQQQQ	7	100	7	1	711	717	93	SGYYSYPGHQNQQPPGFRQAQQLQHQQQSS	HYGGHGYVSPYHSQAVMSLEHLHHQYQQQQ	GO:0005575:cellular_component;	GO:0008150:biological_process;	GO:0003674:molecular_function;	---
>prot|EG:AT3G20310.1-P|cod|AT3G20310.1-TAIR|gene|AT3G20310-TAIR-G|ann|ERF7 (ETHYLINE RESPONSE FACTOR 7); DNA binding / protein binding / transcription factor/ transcription repressor; Encodes a member of the ERF (ethylene response factor) subfamily B-1 of ERF/AP2 transcription factor family (ATERF-7). The protein contains one AP2 domain. Phosphorylated by PKS3 in vitro. Involved in ABA-mediated responses. Acts as a repressor of GCC box–mediated transcription together with AtSin3 and HDA19.	244	1	QEQQQQQ	7	85.7142857142857	5	0.714285714285714	128	134	52	LHNQNLCSPPVIQNQIDPFMDHRLYGGGNF	IISRPASSSMSSTVKSCSGPRPMEAAAASS	GO:0005634:nucleus;	GO:0006350:transcription;GO:0006355:regulation of transcription, DNA-dependent;GO:0006952:defense response;GO:0009414:response to water deprivation;GO:0009737:response to abscisic acid stimulus;GO:0009873:ethylene mediated signaling pathway;GO:0045449:regulation of transcription;	GO:0003677:DNA binding;GO:0003700:sequence-specific DNA binding transcription factor activity;GO:0005515:protein binding;GO:0016564:transcription repressor activity;	---
>prot|EG:AT1G49050.1-P|cod|AT1G49050.1-TAIR|gene|AT1G49050-TAIR-G|ann|aspartyl protease family protein; aspartyl protease family protein; FUNCTIONS IN: aspartic-type endopeptidase activity; INVOLVED IN: proteolysis; EXPRESSED IN: 24 plant structures; EXPRESSED DURING: 13 growth stages; CONTAINS InterPro DOMAIN/s: Peptidase aspartic, catalytic (InterPro:IPR009007), Peptidase A1 (InterPro:IPR001461); BEST Arabidopsis thaliana protein match is: nucellin protein, putative (TAIR:AT1G77480.1); Has 1514 Blast hits to 1509 proteins in 124 species: Archae - 0; Bacteria - 0; Metazoa - 387; Fungi - 84; Plants - 981; Viruses - 0; Other Eukaryotes - 62 (source: NCBI BLink).	583	1	QQQQQ	5	100	5	1	8	12	1	MEPDLHDQQQQQRVHSVVIITLPPSDDPSQ	RVHSVVIITLPPSDDPSQGKTISAFTLTDH	GO:0005575:cellular_component;GO:0012505:endomembrane system;	GO:0006414:translational elongation;GO:0006508:proteolysis;	GO:0004190:aspartic-type endopeptidase activity;GO:0008233:peptidase activity;GO:0016787:hydrolase activity;GO:0030533:triplet codon-amino acid adaptor activity;	---
>prot|EG:AT3G22380.2-P|cod|AT3G22380.2-TAIR|gene|AT3G22380-TAIR-G|ann|TIC (TIME FOR COFFEE); Encodes a nucleus-acting plant-specific clock regulator working close to the central oscillator and affecting the circadian gating of light responses. Circadian gating is the alteration of circadian phase according to the photoperiod of the entraining day/light cycle and the rhythmic antagonism of light responses in the early subjective night. TIC differentially regulates CCA1 and PRR9 from LHY, with LHY expression as a dominant genetic target of TIC action.	1555	2	QQLLQQQQQQ	10	80	6	0.6	1177	1186	75	SGSIVDSSSRLLNLGSALPQSSGSLPTSHH	HMQRSQSQQPYTTMYLQKQQRYATSVAASA	GO:0005634:nucleus;	GO:0042752:regulation of circadian rhythm;GO:0048511:rhythmic process;	GO:0003674:molecular_function;	---
>prot|EG:AT3G22380.2-P|cod|AT3G22380.2-TAIR|gene|AT3G22380-TAIR-G|ann|TIC (TIME FOR COFFEE); Encodes a nucleus-acting plant-specific clock regulator working close to the central oscillator and affecting the circadian gating of light responses. Circadian gating is the alteration of circadian phase according to the photoperiod of the entraining day/light cycle and the rhythmic antagonism of light responses in the early subjective night. TIC differentially regulates CCA1 and PRR9 from LHY, with LHY expression as a dominant genetic target of TIC action.	1555	2	QQQQQ	5	100	5	1	1426	1430	91	QPASAASSAGGRNNGPSVLGNPTTSSGSKS	LPKHGLQPQAQLFFSNPYMQAQHQHQQQQI	GO:0005634:nucleus;	GO:0042752:regulation of circadian rhythm;GO:0048511:rhythmic process;	GO:0003674:molecular_function;	---
>prot|EG:AT2G44740.1-P|cod|AT2G44740.1-TAIR|gene|AT2G44740-TAIR-G|ann|CYCP4;1 (cyclin p4;1); cyclin-dependent protein kinase; cyclin p4;1 (CYCP4;1); FUNCTIONS IN: cyclin-dependent protein kinase activity; INVOLVED IN: regulation of cell cycle; EXPRESSED IN: 22 plant structures; EXPRESSED DURING: 13 growth stages; CONTAINS InterPro DOMAIN/s: Negative regulatory factor PREG (InterPro:IPR012389), Cyclin-like (InterPro:IPR011028), Cyclin, N-terminal (InterPro:IPR006671), Cyclin (InterPro:IPR006670); BEST Arabidopsis thaliana protein match is: CYCP4;3 (cyclin p4;3); cyclin-dependent protein kinase (TAIR:AT5G07450.1); Has 1029 Blast hits to 996 proteins in 161 species: Archae - 0; Bacteria - 16; Metazoa - 208; Fungi - 454; Plants - 130; Viruses - 0; Other Eukaryotes - 221 (source: NCBI BLink).	202	1	QKQQQQQ	7	85.7142857142857	5	0.714285714285714	193	199	95	KEMTLLQPLSLVVVPSSRSLITFNDDEASH	LAV	GO:0005575:cellular_component;	GO:0007049:cell cycle;GO:0008150:biological_process;GO:0051301:cell division;GO:0051726:regulation of cell cycle;	GO:0003674:molecular_function;GO:0004693:cyclin-dependent protein kinase activity;GO:0005515:protein binding;	---
>prot|EG:AT1G16490.1-P|cod|AT1G16490.1-TAIR|gene|AT1G16490-TAIR-G|ann|MYB58 (MYB DOMAIN PROTEIN 58); DNA binding / transcription activator/ transcription factor; Member of the R2R3 factor gene family.	274	1	QQQQQQHKQ	9	77.7777777777778	6	0.666666666666667	247	255	90	NRALQESEEDEVDKWFKHLESELGLEENDN	GTEDEHSSSLLESYELLIH	GO:0005634:nucleus;	GO:0006355:regulation of transcription, DNA-dependent;GO:0009809:lignin biosynthetic process;GO:0045449:regulation of transcription;	GO:0003677:DNA binding;GO:0003700:sequence-specific DNA binding transcription factor activity;GO:0016563:transcription activator activity;	---
>prot|EG:AT5G48560.1-P|cod|AT5G48560.1-TAIR|gene|AT5G48560-TAIR-G|ann|basic helix-loop-helix (bHLH) family protein; basic helix-loop-helix (bHLH) family protein; FUNCTIONS IN: transcription factor activity, DNA binding; INVOLVED IN: regulation of transcription; LOCATED IN: nucleus; EXPRESSED IN: 14 plant structures; EXPRESSED DURING: LP.06 six leaves visible, 4 anthesis, LP.04 four leaves visible, petal differentiation and expansion stage, LP.08 eight leaves visible; CONTAINS InterPro DOMAIN/s: Basic helix-loop-helix dimerisation region bHLH (InterPro:IPR001092), Helix-loop-helix DNA-binding (InterPro:IPR011598); BEST Arabidopsis thaliana protein match is: basic helix-loop-helix (bHLH) family protein (TAIR:AT3G07340.1); Has 1985 Blast hits to 1807 proteins in 161 species: Archae - 0; Bacteria - 13; Metazoa - 190; Fungi - 79; Plants - 1294; Viruses - 1; Other Eukaryotes - 408 (source: NCBI BLink).	498	1	QQQQQ	5	100	5	1	56	60	11	SSSSAMMLNWALMDPNPHQDSSFLWEKSTE	SIFDSALSSLVSSPTPSNSNFSGGGGDGFL	GO:0005634:nucleus;	GO:0006350:transcription;GO:0045449:regulation of transcription;	GO:0003677:DNA binding;GO:0003700:sequence-specific DNA binding transcription factor activity;GO:0030528:transcription regulator activity;	---
>prot|EG:AT1G26610.1-P|cod|AT1G26610.1-TAIR|gene|AT1G26610-TAIR-G|ann|zinc finger (C2H2 type) family protein; zinc finger (C2H2 type) family protein; FUNCTIONS IN: transcription factor activity, zinc ion binding, nucleic acid binding; INVOLVED IN: regulation of transcription; LOCATED IN: intracellular; EXPRESSED IN: 23 plant structures; EXPRESSED DURING: 14 growth stages; CONTAINS InterPro DOMAIN/s: Zinc finger, C2H2-like (InterPro:IPR015880), Zinc finger, C2H2-type (InterPro:IPR007087); BEST Arabidopsis thaliana protein match is: zinc finger (C2H2 type) family protein (TAIR:AT1G26590.1); Has 1803 Blast hits to 1532 proteins in 99 species: Archae - 0; Bacteria - 0; Metazoa - 1356; Fungi - 6; Plants - 361; Viruses - 6; Other Eukaryotes - 74 (source: NCBI BLink).	455	1	QQQQQQQLQ	9	88.8888888888889	7	0.777777777777778	82	90	18	ENGGQSSYGLRENPKKNKRFVDHRQIMALK	ELRRCRECGKGFVSSKALCGHMACHSEREK	GO:0005622:intracellular;	GO:0045449:regulation of transcription;	GO:0003676:nucleic acid binding;GO:0003700:sequence-specific DNA binding transcription factor activity;GO:0008270:zinc ion binding;	---
>prot|EG:AT5G23280.1-P|cod|AT5G23280.1-TAIR|gene|AT5G23280-TAIR-G|ann|TCP family transcription factor, putative; TCP family transcription factor, putative; FUNCTIONS IN: transcription factor activity; INVOLVED IN: regulation of transcription; LOCATED IN: cellular_component unknown; CONTAINS InterPro DOMAIN/s: Transcription factor, TCP (InterPro:IPR005333), Transcription factor TCP subgroup (InterPro:IPR017887); BEST Arabidopsis thaliana protein match is: TCP family transcription factor, putative (TAIR:AT5G08330.1); Has 679 Blast hits to 678 proteins in 154 species: Archae - 0; Bacteria - 0; Metazoa - 26; Fungi - 0; Plants - 639; Viruses - 0; Other Eukaryotes - 14 (source: NCBI BLink).	250	1	QQQQQQ	6	100	6	1	205	210	82	DFGQVWSFAGAPQEMFLQQQHHHQQPLFVH	AAMGEASAARVGNYLPGHLNLLASLSGGSP	GO:0005575:cellular_component;GO:0005634:nucleus;	GO:0006350:transcription;GO:0045449:regulation of transcription;	GO:0003677:DNA binding;GO:0003700:sequence-specific DNA binding transcription factor activity;	---
>prot|EG:AT1G79000.1-P|cod|AT1G79000.1-TAIR|gene|AT1G79000-TAIR-G|ann|HAC1 (HISTONE ACETYLTRANSFERASE OF THE CBP FAMILY 1); H3/H4 histone acetyltransferase/ histone acetyltransferase/ transcription cofactor; Homologous to CREB-binding protein, a co-activator of transcription with histone acetyl-transferase activity. No single prior lysine acetylation is sufficient to block HAC1 acetylation of the H3 or H4 peptides, suggesting that HAC1, HAC5, and HAC12 can acetylate any of several lysines present in the peptides. HAM2 acetylates histone H4 lysine 5. A plant line expressing an RNAi construct targeted against HAC1 has reduced rates of agrobacterium-mediated root transformation.	1697	1	QQQQQ	5	100	5	1	419	423	24	VSRTSSSLSHQQQQFQQQPNRFQQQPNQFH	FLHQQQLKQQSQQQQRFISHDAFGQNNVAS	GO:0005634:nucleus;	GO:0006350:transcription;GO:0006355:regulation of transcription, DNA-dependent;GO:0006358:regulation of transcription from RNA polymerase II promoter, global;GO:0006473:protein amino acid acetylation;GO:0009294:DNA mediated transformation;GO:0009908:flower development;GO:0016568:chromatin modification;GO:0045449:regulation of transcription;GO:0048573:photoperiodism, flowering;	GO:0003712:transcription cofactor activity;GO:0003713:transcription coactivator activity;GO:0004402:histone acetyltransferase activity;GO:0005515:protein binding;GO:0008270:zinc ion binding;GO:0008415:acyltransferase activity;GO:0016740:transferase activity;GO:0046872:metal ion binding;	---
>prot|EG:AT3G15030.2-P|cod|AT3G15030.2-TAIR|gene|AT3G15030-TAIR-G|ann|TCP4 (TCP family transcription factor 4); transcription factor; Arabidopsis thaliana TCP family transcription factor. Regulated by miR319. Involved in heterchronic regulation of leaf differentiation.	420	1	QQQQQQQQLQ	10	90	8	0.8	141	150	33	PADAIRLAAANAKPRRTTAKTQISPSPPPP	FGVGFNGGGAEHPSNNESSFLPPSMDSDSI	GO:0005575:cellular_component;GO:0005634:nucleus;	GO:0006350:transcription;GO:0007275:multicellular organismal development;GO:0009793:embryo development ending in seed dormancy;GO:0009965:leaf morphogenesis;GO:0030154:cell differentiation;GO:0045449:regulation of transcription;GO:0045962:positive regulation of development, heterochronic;GO:0048366:leaf development;	GO:0003677:DNA binding;GO:0003700:sequence-specific DNA binding transcription factor activity;	---
>prot|EG:AT1G17440.2-P|cod|AT1G17440.2-TAIR|gene|AT1G17440-TAIR-G|ann|EER4 (ENHANCED ETHYLENE RESPONSE 4); DNA binding / transcription initiation factor; Encodes one of two Arabidopsis proteins with similarity to the TBP-associated factor TAF12. The gene product is an EIN3-interacting TFIID transcription factor required for proper ethylene response, including ERF1 induction. Loss of function mutants show enhanced response to ethylene. Located in nucleus and expressed throughout the plant. Required for ERF1 expression.	683	5	QQQQQIMQQ	9	77.7777777777778	5	0.555555555555556	123	131	18	PSPSPLSHPSSSLDQQTQTQQLVQQTQQLP	ISSSPIPQLSPQQQQILQQQHMTSQQIPMS	GO:0005634:nucleus;GO:0005669:transcription factor TFIID complex;	GO:0006352:transcription initiation;GO:0009867:jasmonic acid mediated signaling pathway;GO:0010104:regulation of ethylene mediated signaling pathway;	GO:0003677:DNA binding;GO:0016986:transcription initiation factor activity;	---
>prot|EG:AT1G17440.2-P|cod|AT1G17440.2-TAIR|gene|AT1G17440-TAIR-G|ann|EER4 (ENHANCED ETHYLENE RESPONSE 4); DNA binding / transcription initiation factor; Encodes one of two Arabidopsis proteins with similarity to the TBP-associated factor TAF12. The gene product is an EIN3-interacting TFIID transcription factor required for proper ethylene response, including ERF1 induction. Loss of function mutants show enhanced response to ethylene. Located in nucleus and expressed throughout the plant. Required for ERF1 expression.	683	5	QIQQQQQQQHQGQ	13	76.9230769230769	7	0.538461538461538	180	192	26	QQHMTSQQIPMSSYQIAQSLQRSPSLSRLS	YGNVLRQQAGLYGTMNFGGSGSVQQSQQNQ	GO:0005634:nucleus;GO:0005669:transcription factor TFIID complex;	GO:0006352:transcription initiation;GO:0009867:jasmonic acid mediated signaling pathway;GO:0010104:regulation of ethylene mediated signaling pathway;	GO:0003677:DNA binding;GO:0016986:transcription initiation factor activity;	---
>prot|EG:AT1G17440.2-P|cod|AT1G17440.2-TAIR|gene|AT1G17440-TAIR-G|ann|EER4 (ENHANCED ETHYLENE RESPONSE 4); DNA binding / transcription initiation factor; Encodes one of two Arabidopsis proteins with similarity to the TBP-associated factor TAF12. The gene product is an EIN3-interacting TFIID transcription factor required for proper ethylene response, including ERF1 induction. Loss of function mutants show enhanced response to ethylene. Located in nucleus and expressed throughout the plant. Required for ERF1 expression.	683	5	QQQQQQQQQ	9	100	9	1	398	406	58	SQQQWLKQMSGITSPNSFRLQPSQRQALLL	LSSPQLHQSSMSLNQQQISQIIQQQQQQSQ	GO:0005634:nucleus;GO:0005669:transcription factor TFIID complex;	GO:0006352:transcription initiation;GO:0009867:jasmonic acid mediated signaling pathway;GO:0010104:regulation of ethylene mediated signaling pathway;	GO:0003677:DNA binding;GO:0016986:transcription initiation factor activity;	---
>prot|EG:AT1G17440.2-P|cod|AT1G17440.2-TAIR|gene|AT1G17440-TAIR-G|ann|EER4 (ENHANCED ETHYLENE RESPONSE 4); DNA binding / transcription initiation factor; Encodes one of two Arabidopsis proteins with similarity to the TBP-associated factor TAF12. The gene product is an EIN3-interacting TFIID transcription factor required for proper ethylene response, including ERF1 induction. Loss of function mutants show enhanced response to ethylene. Located in nucleus and expressed throughout the plant. Required for ERF1 expression.	683	5	QQQQQQSQ	8	87.5	6	0.75	429	436	62	QQQQQQQQLSSPQLHQSSMSLNQQQISQII	LGQSQMNQSHSQQQLQQMQQQLQQQPQQQM	GO:0005634:nucleus;GO:0005669:transcription factor TFIID complex;	GO:0006352:transcription initiation;GO:0009867:jasmonic acid mediated signaling pathway;GO:0010104:regulation of ethylene mediated signaling pathway;	GO:0003677:DNA binding;GO:0016986:transcription initiation factor activity;	---
>prot|EG:AT1G17440.2-P|cod|AT1G17440.2-TAIR|gene|AT1G17440-TAIR-G|ann|EER4 (ENHANCED ETHYLENE RESPONSE 4); DNA binding / transcription initiation factor; Encodes one of two Arabidopsis proteins with similarity to the TBP-associated factor TAF12. The gene product is an EIN3-interacting TFIID transcription factor required for proper ethylene response, including ERF1 induction. Loss of function mutants show enhanced response to ethylene. Located in nucleus and expressed throughout the plant. Required for ERF1 expression.	683	5	QQQLQQMQQQLQQQPQQQMQQQQQQQQQMQINQQQ	35	77.1428571428572	9	0.257142857142857	448	482	65	SLNQQQISQIIQQQQQQSQLGQSQMNQSHS	PSPRMLSHAGQKSVSLTGSQPEATQSGTTT	GO:0005634:nucleus;GO:0005669:transcription factor TFIID complex;	GO:0006352:transcription initiation;GO:0009867:jasmonic acid mediated signaling pathway;GO:0010104:regulation of ethylene mediated signaling pathway;	GO:0003677:DNA binding;GO:0016986:transcription initiation factor activity;	---
>prot|EG:AT4G24580.1-P|cod|AT4G24580.1-TAIR|gene|AT4G24580-TAIR-G|ann|REN1 (ROP1 ENHANCER 1); Rho GTPase activator/ Rho GTPase binding / phosphoinositide binding; Encodes a Rho GTPase-activating protein that interacts with ROP1 (a Rho GTPase) and regulates pollen tube development. This protein can be observed at the apical tip of growing pollen tubes and on endocytic vesicles traveling to this region of the pollen tube.	939	1	QPNQQQQQQ	9	77.7777777777778	6	0.666666666666667	17	25	1	MANKNAESSSQPPPHVQPNQQQQQQPPIAN	PPIANEQEQEPHGDTCSIPPAQSGNTDSRS	GO:0005622:intracellular;GO:0005938:cell cortex;GO:0045177:apical part of cell;GO:0070382:exocytic vesicle;	GO:0007165:signal transduction;GO:0009846:pollen germination;GO:0009865:pollen tube adhesion;GO:0032862:activation of Rho GTPase activity;GO:0035024:negative regulation of Rho protein signal transduction;GO:0048868:pollen tube development;	GO:0005100:Rho GTPase activator activity;GO:0017048:Rho GTPase binding;GO:0035091:phosphoinositide binding;	---
>prot|EG:AT5G21960.1-P|cod|AT5G21960.1-TAIR|gene|AT5G21960-TAIR-G|ann|AP2 domain-containing transcription factor, putative; encodes a member of the DREB subfamily A-5 of ERF/AP2 transcription factor family. The protein contains one AP2 domain. There are 15 members in this subfamily including RAP2.1, RAP2.9 and RAP2.10.	216	1	QQQQQHQ	7	85.7142857142857	5	0.714285714285714	185	191	85	WEEENFVGPPNSDHEFGFFTDDSTNLYFPT	LSSDFYYDGACEDDFSHYNINLWNF	GO:0005575:cellular_component;GO:0005622:intracellular;GO:0005634:nucleus;GO:0005840:ribosome;	GO:0006350:transcription;GO:0006355:regulation of transcription, DNA-dependent;GO:0006412:translation;GO:0006414:translational elongation;GO:0009873:ethylene mediated signaling pathway;GO:0045449:regulation of transcription;	GO:0003677:DNA binding;GO:0003700:sequence-specific DNA binding transcription factor activity;GO:0003735:structural constituent of ribosome;GO:0030533:triplet codon-amino acid adaptor activity;	---
>prot|EG:AT5G12330.2-P|cod|AT5G12330.2-TAIR|gene|AT5G12330-TAIR-G|ann|LRP1 (LATERAL ROOT PRIMORDIUM 1); protein homodimerization; A member of SHI gene family. Arabidopsis thaliana has ten members that encode proteins with a RING finger-like zinc finger motif. Despite being highly divergent in sequence, many of the SHI-related genes are partially redundant in function and synergistically promote gynoecium, stamen and leaf development in Arabidopsis. Expressed in lateral root primordia and induced by auxin. SWP1 is involved in the repression of LRP1 via histone deacetylation.	320	1	QQQQQQQ	7	100	7	1	186	192	58	RQVMPTGANPTAGSSLSTSSGTKKPRIVGS	ATSHTSTSNTPPQSFETSSSRQDGGGSREA	GO:0005575:cellular_component;	GO:0009733:response to auxin stimulus;GO:0048364:root development;	GO:0042803:protein homodimerization activity;	---
>prot|EG:AT1G33240.1-P|cod|AT1G33240.1-TAIR|gene|AT1G33240-TAIR-G|ann|AT-GTL1 (GT2-LIKE 1); DNA binding / transcription factor; Encodes a plant transcriptional activator that contains two separate, but similar, trihelix DNA-binding domains, similar to GT-2. Gene is expressed in all aerial parts of the plant, with higher level of expression in siliques. At-GTL2 was thought to be a duplicated copy of this gene but is likely to be a cloning artefact, the result of a chimeric clone.	669	1	QQQQQLQQQ	9	88.8888888888889	5	0.555555555555556	595	603	88	GSASTEEEEPIEESPQGTEKPEDLVMRELI	ESMIGEYEKIEESHNYNNMEEEEDQEMDEE	GO:0005634:nucleus;GO:0016021:integral to membrane;	GO:0006468:protein amino acid phosphorylation;GO:0006813:potassium ion transport;	GO:0003677:DNA binding;GO:0003700:sequence-specific DNA binding transcription factor activity;GO:0004672:protein kinase activity;GO:0005249:voltage-gated potassium channel activity;GO:0005524:ATP binding;	---
>prot|EG:AT4G28690.1-P|cod|AT4G28690.1-TAIR|gene|AT4G28690-TAIR-G|ann|unknown protein; LOCATED IN: cellular_component unknown; BEST Arabidopsis thaliana protein match is: RIN13 (RPM1 INTERACTING PROTEIN 13) (TAIR:AT2G20310.1); Has 370 Blast hits to 352 proteins in 105 species: Archae - 0; Bacteria - 10; Metazoa - 143; Fungi - 82; Plants - 80; Viruses - 3; Other Eukaryotes - 52 (source: NCBI BLink).	448	1	QQQQQQQ	7	100	7	1	399	405	89	KEAKQFSRNMYSANVQTNAVPTMTPNPPAV	SGRSNDRVLSEFEDWLLDDSTLPCPSSVQD	GO:0005575:cellular_component;	---	---	---
>prot|EG:AT4G26150.1-P|cod|AT4G26150.1-TAIR|gene|AT4G26150-TAIR-G|ann|CGA1 (CYTOKININ-RESPONSIVE GATA FACTOR 1); transcription factor; CYTOKININ-RESPONSIVE GATA FACTOR 1 (CGA1); FUNCTIONS IN: transcription factor activity; INVOLVED IN: response to cytokinin stimulus; LOCATED IN: nucleus; EXPRESSED IN: 12 plant structures; EXPRESSED DURING: 6 growth stages; CONTAINS InterPro DOMAIN/s: Zinc finger, NHR/GATA-type (InterPro:IPR013088), Zinc finger, GATA-type (InterPro:IPR000679); BEST Arabidopsis thaliana protein match is: GNC (GATA, nitrate-inducible, carbon metabolism-involved); transcription factor (TAIR:AT5G56860.1); Has 1008 Blast hits to 988 proteins in 123 species: Archae - 0; Bacteria - 0; Metazoa - 85; Fungi - 426; Plants - 402; Viruses - 0; Other Eukaryotes - 95 (source: NCBI BLink).	352	1	QQQQQQQQ	8	100	8	1	33	40	9	SNFHYTIDLNEDQNHQPFFASLGSSLHHHL	HFHHQASSNPSSLMSPSLSYFPFLINSRQD	GO:0005634:nucleus;	GO:0006350:transcription;GO:0006355:regulation of transcription, DNA-dependent;GO:0009735:response to cytokinin stimulus;GO:0045449:regulation of transcription;	GO:0003677:DNA binding;GO:0003700:sequence-specific DNA binding transcription factor activity;GO:0008270:zinc ion binding;GO:0043565:sequence-specific DNA binding;GO:0046872:metal ion binding;	---
>prot|EG:AT1G54140.1-P|cod|AT1G54140.1-TAIR|gene|AT1G54140-TAIR-G|ann|TAFII21 (TATA BINDING PROTEIN ASSOCIATED FACTOR 21KDA SUBUNIT); DNA binding / transcription initiation factor; putative TATA binding protein associated factor 21kDa	183	1	QSSQEQQQQQQQ	12	75	7	0.583333333333333	151	162	82	SPNYQLVIPKKSVSTEPEETEDDEEMTDPG	TSDLPSQTPQRVSFPLSRRPK	GO:0005669:transcription factor TFIID complex;	GO:0006352:transcription initiation;	GO:0003677:DNA binding;GO:0016986:transcription initiation factor activity;	---
>prot|EG:AT2G25930.1-P|cod|AT2G25930.1-TAIR|gene|AT2G25930-TAIR-G|ann|ELF3 (EARLY FLOWERING 3); protein C-terminus binding / transcription factor; Encodes a novel nuclear protein that is expressed rhythmically and interacts with phytochrome B to control plant development and flowering through a signal transduction pathway Elf3 controls rhythmic circadian outputs under constant light conditions.	695	3	QQQQQQQ	7	100	7	1	544	550	78	HPGMGFPPPGNGYFPPYGMMPTIMNPYCSS	PNEQMNQFGHPGNLQNTQQQQQRSDNEPAP	GO:0005634:nucleus;	GO:0006350:transcription;GO:0007623:circadian rhythm;GO:0009409:response to cold;GO:0009585:red, far-red light phototransduction;GO:0009733:response to auxin stimulus;GO:0009737:response to abscisic acid stimulus;GO:0009826:unidimensional cell growth;GO:0009909:regulation of flower development;GO:0010017:red or far-red light signaling pathway;GO:0010031:circumnutation;GO:0045449:regulation of transcription;GO:0048573:photoperiodism, flowering;	GO:0003700:sequence-specific DNA binding transcription factor activity;GO:0008022:protein C-terminus binding;	---
>prot|EG:AT2G25930.1-P|cod|AT2G25930.1-TAIR|gene|AT2G25930-TAIR-G|ann|ELF3 (EARLY FLOWERING 3); protein C-terminus binding / transcription factor; Encodes a novel nuclear protein that is expressed rhythmically and interacts with phytochrome B to control plant development and flowering through a signal transduction pathway Elf3 controls rhythmic circadian outputs under constant light conditions.	695	3	QNTQQQQQ	8	75	5	0.625	565	572	81	TIMNPYCSSQQQQQQQPNEQMNQFGHPGNL	RSDNEPAPQQQQQPTKSYPRARKSRQGSTG	GO:0005634:nucleus;	GO:0006350:transcription;GO:0007623:circadian rhythm;GO:0009409:response to cold;GO:0009585:red, far-red light phototransduction;GO:0009733:response to auxin stimulus;GO:0009737:response to abscisic acid stimulus;GO:0009826:unidimensional cell growth;GO:0009909:regulation of flower development;GO:0010017:red or far-red light signaling pathway;GO:0010031:circumnutation;GO:0045449:regulation of transcription;GO:0048573:photoperiodism, flowering;	GO:0003700:sequence-specific DNA binding transcription factor activity;GO:0008022:protein C-terminus binding;	---
>prot|EG:AT2G25930.1-P|cod|AT2G25930.1-TAIR|gene|AT2G25930-TAIR-G|ann|ELF3 (EARLY FLOWERING 3); protein C-terminus binding / transcription factor; Encodes a novel nuclear protein that is expressed rhythmically and interacts with phytochrome B to control plant development and flowering through a signal transduction pathway Elf3 controls rhythmic circadian outputs under constant light conditions.	695	3	QQQQQ	5	100	5	1	581	585	83	PNEQMNQFGHPGNLQNTQQQQQRSDNEPAP	PTKSYPRARKSRQGSTGSSPSGPQGISGSK	GO:0005634:nucleus;	GO:0006350:transcription;GO:0007623:circadian rhythm;GO:0009409:response to cold;GO:0009585:red, far-red light phototransduction;GO:0009733:response to auxin stimulus;GO:0009737:response to abscisic acid stimulus;GO:0009826:unidimensional cell growth;GO:0009909:regulation of flower development;GO:0010017:red or far-red light signaling pathway;GO:0010031:circumnutation;GO:0045449:regulation of transcription;GO:0048573:photoperiodism, flowering;	GO:0003700:sequence-specific DNA binding transcription factor activity;GO:0008022:protein C-terminus binding;	---
>prot|EG:AT3G19290.1-P|cod|AT3G19290.1-TAIR|gene|AT3G19290-TAIR-G|ann|ABF4 (ABRE BINDING FACTOR 4); DNA binding / protein binding / transcription activator/ transcription factor; bZIP transcription factor with specificity for abscisic acid-responsive elements (ABRE). Mediate ABA-dependent stress responses.	431	1	QQQQQQQQLLQQQQQQMQQLNQ	22	77.2727272727273	8	0.363636363636364	239	260	55	NQNSITFNGTNDSMILNQPPGLGLKMGGTM	PHPQQRLPQTIFPKQANVAFSAPVNITNKG	GO:0005634:nucleus;	GO:0006350:transcription;GO:0006355:regulation of transcription, DNA-dependent;GO:0006950:response to stress;GO:0009414:response to water deprivation;GO:0009651:response to salt stress;GO:0009737:response to abscisic acid stimulus;GO:0009738:abscisic acid mediated signaling pathway;GO:0045449:regulation of transcription;	GO:0003677:DNA binding;GO:0003700:sequence-specific DNA binding transcription factor activity;GO:0005515:protein binding;GO:0016563:transcription activator activity;GO:0043565:sequence-specific DNA binding;GO:0046983:protein dimerization activity;	---
>prot|EG:AT4G00050.1-P|cod|AT4G00050.1-TAIR|gene|AT4G00050-TAIR-G|ann|UNE10 (unfertilized embryo sac 10); DNA binding / transcription factor; unfertilized embryo sac 10 (UNE10); FUNCTIONS IN: transcription factor activity, DNA binding; INVOLVED IN: double fertilization forming a zygote and endosperm, regulation of transcription; LOCATED IN: nucleus; EXPRESSED IN: 20 plant structures; EXPRESSED DURING: 13 growth stages; CONTAINS InterPro DOMAIN/s: Basic helix-loop-helix dimerisation region bHLH (InterPro:IPR001092), Helix-loop-helix DNA-binding (InterPro:IPR011598); BEST Arabidopsis thaliana protein match is: PIF7 (PHYTOCHROME-INTERACTING FACTOR7); DNA binding / double-stranded DNA binding / transcription factor (TAIR:AT5G61270.1); Has 2238 Blast hits to 2238 proteins in 169 species: Archae - 0; Bacteria - 0; Metazoa - 330; Fungi - 36; Plants - 1869; Viruses - 0; Other Eukaryotes - 3 (source: NCBI BLink).	399	1	QQQQQLQ	7	85.7142857142857	5	0.714285714285714	284	290	71	EVIEYLKQLQAQVSMMSRMNMPSMMLPMAM	MSLMSNPMGLGMGMGMPGLGLLDLNSMNRA	GO:0005634:nucleus;	GO:0006350:transcription;GO:0009567:double fertilization forming a zygote and endosperm;GO:0045449:regulation of transcription;	GO:0003677:DNA binding;GO:0003700:sequence-specific DNA binding transcription factor activity;GO:0030528:transcription regulator activity;	---
>prot|EG:AT3G62670.1-P|cod|AT3G62670.1-TAIR|gene|AT3G62670-TAIR-G|ann|ARR20 (ARABIDOPSIS RESPONSE REGULATOR 20); transcription factor/ two-component response regulator; member of Response Regulator: B- Type	426	1	QQQQQHQQYQ	10	80	5	0.5	359	368	84	YPSTSCLPVNNNNCFMTNPSTYIDQFQHQL	STLNSISAMLTKQESRHVPSSAMENSEPLM	GO:0005634:nucleus;	GO:0000160:two-component signal transduction system (phosphorelay);GO:0006350:transcription;GO:0006355:regulation of transcription, DNA-dependent;GO:0009736:cytokinin mediated signaling pathway;GO:0009793:embryo development ending in seed dormancy;GO:0045449:regulation of transcription;	GO:0000156:two-component response regulator activity;GO:0003677:DNA binding;GO:0003700:sequence-specific DNA binding transcription factor activity;	---
>prot|EG:AT5G46400.1-P|cod|AT5G46400.1-TAIR|gene|AT5G46400-TAIR-G|ann|PRP39-2; PRP39-2; INVOLVED IN: RNA processing; LOCATED IN: intracellular; EXPRESSED IN: 21 plant structures; EXPRESSED DURING: 13 growth stages; CONTAINS InterPro DOMAIN/s: RNA-processing protein, HAT helix (InterPro:IPR003107); BEST Arabidopsis thaliana protein match is: PRP39; binding (TAIR:AT1G04080.1); Has 39577 Blast hits to 18233 proteins in 717 species: Archae - 6; Bacteria - 1449; Metazoa - 13066; Fungi - 4212; Plants - 3374; Viruses - 183; Other Eukaryotes - 17287 (source: NCBI BLink).	1036	2	QQQQQ	5	100	5	1	894	898	86	QSNYQQEGQMQSHEAYNQMWQQYYYSYYYY	LMSEQPQPNQNPQPQLDQNLVQLLSKQYQS	GO:0005622:intracellular;	GO:0006396:RNA processing;	---	---
>prot|EG:AT5G46400.1-P|cod|AT5G46400.1-TAIR|gene|AT5G46400-TAIR-G|ann|PRP39-2; PRP39-2; INVOLVED IN: RNA processing; LOCATED IN: intracellular; EXPRESSED IN: 21 plant structures; EXPRESSED DURING: 13 growth stages; CONTAINS InterPro DOMAIN/s: RNA-processing protein, HAT helix (InterPro:IPR003107); BEST Arabidopsis thaliana protein match is: PRP39; binding (TAIR:AT1G04080.1); Has 39577 Blast hits to 18233 proteins in 717 species: Archae - 6; Bacteria - 1449; Metazoa - 13066; Fungi - 4212; Plants - 3374; Viruses - 183; Other Eukaryotes - 17287 (source: NCBI BLink).	1036	2	QNQQQIQFQQQQQQQEWFQQQQQWQQQQ	28	75	7	0.25	953	980	91	SKQYQSQAKTQYLQPQQVEQVNTQQQSQEP	YLLYIQQQQLQGEAKGDEQRLSMPQGSTTN	GO:0005622:intracellular;	GO:0006396:RNA processing;	---	---
>prot|EG:AT4G27000.1-P|cod|AT4G27000.1-TAIR|gene|AT4G27000-TAIR-G|ann|ATRBP45C; RNA binding; ATRBP45C; FUNCTIONS IN: RNA binding; EXPRESSED IN: 24 plant structures; EXPRESSED DURING: 15 growth stages; CONTAINS InterPro DOMAIN/s: RNA recognition motif, RNP-1 (InterPro:IPR000504), Nucleotide-binding, alpha-beta plait (InterPro:IPR012677); BEST Arabidopsis thaliana protein match is: ATRBP45A (RNA-binding protein 45A); RNA binding (TAIR:AT5G54900.1); Has 24066 Blast hits to 14859 proteins in 588 species: Archae - 10; Bacteria - 1237; Metazoa - 14401; Fungi - 2729; Plants - 3582; Viruses - 5; Other Eukaryotes - 2102 (source: NCBI BLink).	415	2	QHQQQQQGQ	9	77.7777777777778	5	0.555555555555556	36	44	8	PPASNGAATGPGQIPSDQQAYLQQQQSWMM	PPAGWNQQSAPSSGQPQQQQYGGGGSQNPG	---	---	GO:0000166:nucleotide binding;GO:0003676:nucleic acid binding;GO:0003723:RNA binding;	---
>prot|EG:AT4G27000.1-P|cod|AT4G27000.1-TAIR|gene|AT4G27000-TAIR-G|ann|ATRBP45C; RNA binding; ATRBP45C; FUNCTIONS IN: RNA binding; EXPRESSED IN: 24 plant structures; EXPRESSED DURING: 15 growth stages; CONTAINS InterPro DOMAIN/s: RNA recognition motif, RNP-1 (InterPro:IPR000504), Nucleotide-binding, alpha-beta plait (InterPro:IPR012677); BEST Arabidopsis thaliana protein match is: ATRBP45A (RNA-binding protein 45A); RNA binding (TAIR:AT5G54900.1); Has 24066 Blast hits to 14859 proteins in 588 species: Archae - 10; Bacteria - 1237; Metazoa - 14401; Fungi - 2729; Plants - 3582; Viruses - 5; Other Eukaryotes - 2102 (source: NCBI BLink).	415	2	QQQQQ	5	100	5	1	411	415	99	GYAPPPQDPNAYYGGYAGGGYGNYQQPGGY	@	---	---	GO:0000166:nucleotide binding;GO:0003676:nucleic acid binding;GO:0003723:RNA binding;	---
>prot|EG:AT3G19130.1-P|cod|AT3G19130.1-TAIR|gene|AT3G19130-TAIR-G|ann|ATRBP47B (RNA-binding protein 47B); RNA binding; RNA-binding protein 47B (ATRBP47B); FUNCTIONS IN: RNA binding; EXPRESSED IN: 23 plant structures; EXPRESSED DURING: 14 growth stages; CONTAINS InterPro DOMAIN/s: RNA recognition motif, RNP-1 (InterPro:IPR000504), Nucleotide-binding, alpha-beta plait (InterPro:IPR012677); BEST Arabidopsis thaliana protein match is: ATRBP47A (Arabidopsis thaliana RNA-binding protein 47a); RNA binding (TAIR:AT1G49600.1); Has 30014 Blast hits to 17093 proteins in 630 species: Archae - 14; Bacteria - 1495; Metazoa - 16452; Fungi - 3232; Plants - 4155; Viruses - 9; Other Eukaryotes - 4657 (source: NCBI BLink).	435	1	QQWQQQQQQQQQ	12	91.6666666666667	9	0.75	28	39	6	MQTTNGSDSTLATSGATPPNQQTPPPPQQW	WMAAMQYPPAAAMMMMQQQQMLMYPHQYVP	---	---	GO:0000166:nucleotide binding;GO:0003676:nucleic acid binding;GO:0003723:RNA binding;	---
>prot|EG:AT2G40925.1-P|cod|AT2G40925.1-TAIR|gene|AT2G40925-TAIR-G|ann|F-box family protein; F-box family protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: chloroplast; CONTAINS InterPro DOMAIN/s: Cyclin-like F-box (InterPro:IPR001810), F-box associated type 3 (InterPro:IPR013187), F-box associated type 1 (InterPro:IPR017451); BEST Arabidopsis thaliana protein match is: F-box protein-related (TAIR:AT2G40910.2); Has 827 Blast hits to 814 proteins in 38 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 825; Viruses - 0; Other Eukaryotes - 2 (source: NCBI BLink).	403	1	QQQQQ	5	100	5	1	74	78	18	FMRFKCVSKQWSPLISGRYFCNRLFTCVTR	PRLYMCLVAKDKQCVLLSSTSPDNTCFVLV	GO:0009507:chloroplast;	GO:0008150:biological_process;	GO:0003674:molecular_function;	---
>prot|EG:AT4G25960.1-P|cod|AT4G25960.1-TAIR|gene|AT4G25960-TAIR-G|ann|PGP2 (P-GLYCOPROTEIN 2); ATPase, coupled to transmembrane movement of substances; P-GLYCOPROTEIN 2 (PGP2); FUNCTIONS IN: ATPase activity, coupled to transmembrane movement of substances; INVOLVED IN: transport; LOCATED IN: membrane; EXPRESSED IN: 22 plant structures; EXPRESSED DURING: 13 growth stages; CONTAINS InterPro DOMAIN/s: ATPase, AAA+ type, core (InterPro:IPR003593), ABC transporter-like (InterPro:IPR003439), ABC transporter, transmembrane region, type 1 (InterPro:IPR011527), ABC transporter integral membrane type 1 (InterPro:IPR017940), ABC transporter, transmembrane region (InterPro:IPR001140), ABC transporter, conserved site (InterPro:IPR017871); BEST Arabidopsis thaliana protein match is: PGP10 (P-GLYCOPROTEIN 10); ATPase, coupled to transmembrane movement of substances (TAIR:AT1G10680.1); Has 503086 Blast hits to 234957 proteins in 2687 species: Archae - 8828; Bacteria - 337128; Metazoa - 15398; Fungi - 8306; Plants - 4562; Viruses - 34; Other Eukaryotes - 128830 (source: NCBI BLink).	1273	1	QQQQQ	5	100	5	1	1268	1272	99	VLHGGKIVEQGSHRKLVLNKSGPYFKLISL	P	GO:0016020:membrane;GO:0016021:integral to membrane;	GO:0006810:transport;	GO:0000166:nucleotide binding;GO:0005524:ATP binding;GO:0016887:ATPase activity;GO:0017111:nucleoside-triphosphatase activity;GO:0042626:ATPase activity, coupled to transmembrane movement of substances;	---
>prot|EG:AT2G46780.1-P|cod|AT2G46780.1-TAIR|gene|AT2G46780-TAIR-G|ann|RNA binding / nucleic acid binding / nucleotide binding; RNA binding / nucleic acid binding / nucleotide binding; FUNCTIONS IN: RNA binding, nucleotide binding, nucleic acid binding; INVOLVED IN: biological_process unknown; LOCATED IN: cellular_component unknown; EXPRESSED IN: 22 plant structures; EXPRESSED DURING: 13 growth stages; CONTAINS InterPro DOMAIN/s: RNA recognition motif, RNP-1 (InterPro:IPR000504), Nucleotide-binding, alpha-beta plait (InterPro:IPR012677); BEST Arabidopsis thaliana protein match is: RNA recognition motif (RRM)-containing protein (TAIR:AT1G33470.2); Has 14373 Blast hits to 11497 proteins in 543 species: Archae - 2; Bacteria - 693; Metazoa - 8215; Fungi - 1420; Plants - 2628; Viruses - 0; Other Eukaryotes - 1415 (source: NCBI BLink).	336	1	QQQQQ	5	100	5	1	145	149	43	GRFRSPGSGVGLVAPSPQFRGSSSSSAFVH	HTAQFPFPYSTYGFSGYSQEGMYPMNYYNH	GO:0005575:cellular_component;	GO:0008150:biological_process;	GO:0000166:nucleotide binding;GO:0003676:nucleic acid binding;GO:0003723:RNA binding;	---
>prot|EG:AT5G12330.3-P|cod|AT5G12330.3-TAIR|gene|AT5G12330-TAIR-G|ann|LRP1 (LATERAL ROOT PRIMORDIUM 1); protein homodimerization; A member of SHI gene family. Arabidopsis thaliana has ten members that encode proteins with a RING finger-like zinc finger motif. Despite being highly divergent in sequence, many of the SHI-related genes are partially redundant in function and synergistically promote gynoecium, stamen and leaf development in Arabidopsis. Expressed in lateral root primordia and induced by auxin. SWP1 is involved in the repression of LRP1 via histone deacetylation.	226	1	QQQQQQQ	7	100	7	1	186	192	82	RQVMPTGANPTAGSSLSTSSGTKKPRIVGS	ATSHTSTSNTPPQSFETSSSRQGSFTFSLV	GO:0005575:cellular_component;	GO:0009733:response to auxin stimulus;GO:0048364:root development;	GO:0042803:protein homodimerization activity;	---
>prot|EG:AT1G54540.1-P|cod|AT1G54540.1-TAIR|gene|AT1G54540-TAIR-G|ann|unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: cellular_component unknown; EXPRESSED IN: hypocotyl, flower, root; EXPRESSED DURING: petal differentiation and expansion stage; CONTAINS InterPro DOMAIN/s: Harpin-induced 1 (InterPro:IPR010847); BEST Arabidopsis thaliana protein match is: harpin-induced protein-related / HIN1-related / harpin-responsive protein-related (TAIR:AT1G65690.1); Has 612 Blast hits to 611 proteins in 22 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 612; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink).	239	1	QQQQQ	5	100	5	1	177	181	74	RFYQGHRNVTKLNVALTGRAQYGNTVLAAL	TGRVPLDLKVNAPVAIKLGNLKMKKIRILG	GO:0005575:cellular_component;	GO:0008150:biological_process;	GO:0003674:molecular_function;	---
>prot|EG:AT5G05410.2-P|cod|AT5G05410.2-TAIR|gene|AT5G05410-TAIR-G|ann|DREB2A; DNA binding / transcription activator/ transcription factor; Encodes a transcription factor that specifically binds to DRE/CRT cis elements (responsive to drought and low-temperature stress). Belongs to the DREB subfamily A-2 of ERF/AP2 transcription factor family (DREB2A). There are eight members in this subfamily including DREB2B. The protein contains one AP2 domain. Overexpression of transcriptional activation domain of DREB2A resulted in significant drought stress tolerance but only slight freezing tolerance in transgenic Arabidopsis plants. Microarray and RNA gel blot analyses revealed that DREB2A regulates expression of many water stress–inducible genes.	302	1	QQQQQ	5	100	5	1	230	234	76	HWLSEFEHNYWSDILKEKEKQKEQGIVETC	DSLSVADYGLNQDRYPGNSVANGSYRPESQ	GO:0005634:nucleus;	GO:0006350:transcription;GO:0006355:regulation of transcription, DNA-dependent;GO:0006950:response to stress;GO:0009408:response to heat;GO:0009414:response to water deprivation;GO:0010224:response to UV-B;GO:0010286:heat acclimation;GO:0042542:response to hydrogen peroxide;GO:0045449:regulation of transcription;	GO:0003677:DNA binding;GO:0003700:sequence-specific DNA binding transcription factor activity;GO:0005515:protein binding;GO:0016563:transcription activator activity;	---
>prot|EG:AT4G15410.1-P|cod|AT4G15410.1-TAIR|gene|AT4G15410-TAIR-G|ann|PUX5 (Arabidopsis thaliana serine/threonine protein phosphatase 2A 55 kDa regulatory subunit B prime gamma); protein binding; Arabidopsis thaliana serine/threonine protein phosphatase 2A 55 kDa regulatory subunit B prime gamma (PUX5); FUNCTIONS IN: protein binding; INVOLVED IN: biological_process unknown; LOCATED IN: cellular_component unknown; EXPRESSED IN: 25 plant structures; EXPRESSED DURING: 14 growth stages; CONTAINS InterPro DOMAIN/s: Ubiquitin-associated/translation elongation factor EF1B, N-terminal, eukaryote (InterPro:IPR015940), UBX (InterPro:IPR001012), SEP (InterPro:IPR012989), UBA-like (InterPro:IPR009060); BEST Arabidopsis thaliana protein match is: PUX4; protein binding (TAIR:AT4G04210.1); Has 2169 Blast hits to 897 proteins in 184 species: Archae - 0; Bacteria - 87; Metazoa - 456; Fungi - 202; Plants - 88; Viruses - 16; Other Eukaryotes - 1320 (source: NCBI BLink).	421	1	QQQQQEQPQ	9	77.7777777777778	5	0.555555555555556	222	230	52	DRPVEPSRSASTSFTGAARLLSGEAVSSSP	RIMHTITFWLNGFTVNDGPLRGFSDPENAA	GO:0005575:cellular_component;	GO:0008150:biological_process;	GO:0003674:molecular_function;GO:0005515:protein binding;	---
>prot|EG:AT1G22330.1-P|cod|AT1G22330.1-TAIR|gene|AT1G22330-TAIR-G|ann|RNA binding / nucleic acid binding / nucleotide binding; RNA binding / nucleic acid binding / nucleotide binding; FUNCTIONS IN: RNA binding, nucleotide binding, nucleic acid binding; INVOLVED IN: biological_process unknown; LOCATED IN: cellular_component unknown; EXPRESSED IN: 20 plant structures; EXPRESSED DURING: 13 growth stages; CONTAINS InterPro DOMAIN/s: RNA recognition motif, RNP-1 (InterPro:IPR000504), Nucleotide-binding, alpha-beta plait (InterPro:IPR012677); BEST Arabidopsis thaliana protein match is: RNA recognition motif (RRM)-containing protein (TAIR:AT1G78260.1); Has 15716 Blast hits to 12796 proteins in 588 species: Archae - 4; Bacteria - 780; Metazoa - 9187; Fungi - 1619; Plants - 2589; Viruses - 0; Other Eukaryotes - 1537 (source: NCBI BLink).	291	1	QQQQQQQQQ	9	100	9	1	214	222	73	NIMPSPYYYLQAPSPRPYLHHQQHYQYHHH	RLPSASSYLIYPSNVEAPTPSNVPTSQGPL	GO:0005575:cellular_component;	GO:0008150:biological_process;	GO:0000166:nucleotide binding;GO:0003676:nucleic acid binding;GO:0003723:RNA binding;	---
>prot|EG:AT1G20670.1-P|cod|AT1G20670.1-TAIR|gene|AT1G20670-TAIR-G|ann|DNA-binding bromodomain-containing protein; DNA-binding bromodomain-containing protein; FUNCTIONS IN: DNA binding; INVOLVED IN: biological_process unknown; LOCATED IN: cellular_component unknown; EXPRESSED IN: 23 plant structures; EXPRESSED DURING: 13 growth stages; CONTAINS InterPro DOMAIN/s: Bromodomain, conserved site (InterPro:IPR018359), Bromodomain (InterPro:IPR001487); BEST Arabidopsis thaliana protein match is: DNA-binding bromodomain-containing protein (TAIR:AT1G76380.2); Has 9864 Blast hits to 6994 proteins in 241 species: Archae - 0; Bacteria - 93; Metazoa - 3979; Fungi - 1018; Plants - 350; Viruses - 7; Other Eukaryotes - 4417 (source: NCBI BLink).	652	2	QQQQQLQQQQQQ	12	91.6666666666667	6	0.5	29	40	4	MGEVADTMTKKKKKGRPSLLDLQKRAIKQQ	HKNNHQDDDDHHHNNNNRSGSKNPNSLNHR	GO:0005575:cellular_component;	GO:0008150:biological_process;	GO:0003677:DNA binding;	---
>prot|EG:AT1G20670.1-P|cod|AT1G20670.1-TAIR|gene|AT1G20670-TAIR-G|ann|DNA-binding bromodomain-containing protein; DNA-binding bromodomain-containing protein; FUNCTIONS IN: DNA binding; INVOLVED IN: biological_process unknown; LOCATED IN: cellular_component unknown; EXPRESSED IN: 23 plant structures; EXPRESSED DURING: 13 growth stages; CONTAINS InterPro DOMAIN/s: Bromodomain, conserved site (InterPro:IPR018359), Bromodomain (InterPro:IPR001487); BEST Arabidopsis thaliana protein match is: DNA-binding bromodomain-containing protein (TAIR:AT1G76380.2); Has 9864 Blast hits to 6994 proteins in 241 species: Archae - 0; Bacteria - 93; Metazoa - 3979; Fungi - 1018; Plants - 350; Viruses - 7; Other Eukaryotes - 4417 (source: NCBI BLink).	652	2	QSQQQQQQQ	9	88.8888888888889	7	0.777777777777778	285	293	43	TVYYRQARAIQELAKKDFENLRQDSDDEEP	PKVARRGRPPKKHPEPSSIDRTASEISADA	GO:0005575:cellular_component;	GO:0008150:biological_process;	GO:0003677:DNA binding;	---
>prot|EG:AT5G49520.1-P|cod|AT5G49520.1-TAIR|gene|AT5G49520-TAIR-G|ann|WRKY48; transcription factor; member of WRKY Transcription Factor; Group II-c	399	1	QQQQQQQ	7	100	7	1	12	18	3	MEKKKEEDHHHQQQQQQQKEIKNTETKIEQ	KEIKNTETKIEQEQEQEQKQEISQASSSSN	GO:0005634:nucleus;	GO:0006350:transcription;GO:0006355:regulation of transcription, DNA-dependent;GO:0010200:response to chitin;GO:0045449:regulation of transcription;	GO:0003677:DNA binding;GO:0003700:sequence-specific DNA binding transcription factor activity;GO:0043565:sequence-specific DNA binding;	---
>prot|EG:AT3G24440.1-P|cod|AT3G24440.1-TAIR|gene|AT3G24440-TAIR-G|ann|VRN5 (VERNALIZATION 5); Encodes Vernalization Insensitive 3-like 1 (VIL1). VIL1 is involved in the photoperiod and vernalization of Arabidopsis by regulating expression of the related floral repressors Flowering Locus C (FLC) and Flowering Locus M (FLM). VIL1, along with VIN3 (Vernalization Insensitive 3) is necessary for the chromatin modification to FLC and FLM.	602	1	QQQQQ	5	100	5	1	30	34	4	MDSSSTKSKISHSRKTNKKSNKKHESNGKQ	DVDGGGGCLRSSWICKNASCRANVPKEDSF	GO:0009507:chloroplast;	GO:0009909:regulation of flower development;GO:0010048:vernalization response;GO:0016568:chromatin modification;GO:0016571:histone methylation;	GO:0003674:molecular_function;	---
>prot|EG:AT2G03710.2-P|cod|AT2G03710.2-TAIR|gene|AT2G03710-TAIR-G|ann|SEP4 (SEPALLATA 4); DNA binding / transcription factor; This gene belongs to the family of SEP genes. It is involved in the development of sepals, petals, stamens and carpels. Additionally, it plays a central role in the determination of flower meristem and organ identity.	257	1	QQQQHQQQQQ	10	90	5	0.5	191	200	74	LLETNRDLRRKLEDSDAALTQSFWGSSAAE	GMSSYQSNPPIQEAGFFKPLQGNVALQMSH	GO:0005634:nucleus;	GO:0006350:transcription;GO:0006355:regulation of transcription, DNA-dependent;GO:0010076:maintenance of floral meristem identity;GO:0045449:regulation of transcription;GO:0048440:carpel development;GO:0048441:petal development;GO:0048442:sepal development;GO:0048443:stamen development;	GO:0003677:DNA binding;GO:0003700:sequence-specific DNA binding transcription factor activity;GO:0005515:protein binding;GO:0043565:sequence-specific DNA binding;	---
>prot|EG:AT1G72310.1-P|cod|AT1G72310.1-TAIR|gene|AT1G72310-TAIR-G|ann|ATL3; protein binding / zinc ion binding; Encodes a putative RING-H2 zinc finger protein ATL3 (ATL3).	324	1	QLQQQQQQQQQEQEQ	15	80	9	0.6	55	69	16	ILTAIIVLFMAVLFVLILHLYAKLYWWRID	EEDQSSIAPPVVTRRQRRRFIFVPGQDALS	GO:0016020:membrane;GO:0016021:integral to membrane;	GO:0019941:modification-dependent protein catabolic process;	GO:0005515:protein binding;GO:0008270:zinc ion binding;GO:0046872:metal ion binding;	---
>prot|EG:AT3G44900.1-P|cod|AT3G44900.1-TAIR|gene|AT3G44900-TAIR-G|ann|ATCHX4 (CATION/H+ EXCHANGER 4); monovalent cation:proton antiporter/ sodium:hydrogen antiporter; member of Putative Na+/H+ antiporter family	817	1	QQQQQ	5	100	5	1	811	815	99	EEWSEFEELGIIGDLLTSQDLNCQASVLVI	MI	GO:0016021:integral to membrane;	GO:0006810:transport;GO:0006812:cation transport;GO:0008152:metabolic process;	GO:0005451:monovalent cation:hydrogen antiporter activity;GO:0008415:acyltransferase activity;GO:0015299:solute:hydrogen antiporter activity;GO:0015385:sodium:hydrogen antiporter activity;	---
>prot|EG:AT1G61660.1-P|cod|AT1G61660.1-TAIR|gene|AT1G61660-TAIR-G|ann|basic helix-loop-helix (bHLH) family protein; basic helix-loop-helix (bHLH) family protein; FUNCTIONS IN: transcription factor activity, DNA binding; INVOLVED IN: regulation of transcription; LOCATED IN: nucleus; EXPRESSED IN: 22 plant structures; EXPRESSED DURING: 13 growth stages; CONTAINS InterPro DOMAIN/s: Basic helix-loop-helix dimerisation region bHLH (InterPro:IPR001092), Helix-loop-helix DNA-binding (InterPro:IPR011598); BEST Arabidopsis thaliana protein match is: ethylene-responsive protein -related (TAIR:AT3G20640.1); Has 1231 Blast hits to 803 proteins in 74 species: Archae - 0; Bacteria - 54; Metazoa - 297; Fungi - 43; Plants - 548; Viruses - 0; Other Eukaryotes - 289 (source: NCBI BLink).	393	1	QQQQQ	5	100	5	1	338	342	86	VLQEAIEYIKFLHDQVTVLSTPYMKQGASN	ISGKSKSQDENENHELRGHGLCLVPISSTF	GO:0005634:nucleus;	GO:0006350:transcription;GO:0045449:regulation of transcription;	GO:0003677:DNA binding;GO:0003700:sequence-specific DNA binding transcription factor activity;GO:0030528:transcription regulator activity;	---
>prot|EG:AT1G21580.1-P|cod|AT1G21580.1-TAIR|gene|AT1G21580-TAIR-G|ann|hydroxyproline-rich glycoprotein family protein; hydroxyproline-rich glycoprotein family protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: cellular_component unknown; EXPRESSED IN: 23 plant structures; EXPRESSED DURING: 13 growth stages; Has 5883 Blast hits to 3865 proteins in 351 species: Archae - 2; Bacteria - 340; Metazoa - 2117; Fungi - 809; Plants - 1304; Viruses - 149; Other Eukaryotes - 1162 (source: NCBI BLink).	1696	1	QQQQQHPQ	8	75	5	0.625	105	112	6	LPPNTVVNQPTSNYYQHPPPLQQQHQPLSL	YIPQQVSYEPQRISQPLTSSIQCTESQSDW	GO:0005575:cellular_component;	GO:0008150:biological_process;	GO:0003674:molecular_function;	---
>prot|EG:AT1G11440.1-P|cod|AT1G11440.1-TAIR|gene|AT1G11440-TAIR-G|ann|unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: cellular_component unknown; EXPRESSED IN: 22 plant structures; EXPRESSED DURING: 13 growth stages; BEST Arabidopsis thaliana protein match is: glycine-rich protein (TAIR:AT3G29075.1); Has 22740 Blast hits to 8622 proteins in 417 species: Archae - 22; Bacteria - 573; Metazoa - 11353; Fungi - 2147; Plants - 905; Viruses - 631; Other Eukaryotes - 7109 (source: NCBI BLink).	363	1	QQQQQ	5	100	5	1	30	34	8	MANFYENYQSPYDYNQVNNLYDQNHYHYNQ	LGFEPMSYNYYNWNESESESEYVAYSGYDD	GO:0005575:cellular_component;	GO:0008150:biological_process;	GO:0003674:molecular_function;GO:0004674:protein serine/threonine kinase activity;GO:0016301:kinase activity;	---
>prot|EG:AT4G32600.1-P|cod|AT4G32600.1-TAIR|gene|AT4G32600-TAIR-G|ann|zinc finger (C3HC4-type RING finger) family protein; zinc finger (C3HC4-type RING finger) family protein; FUNCTIONS IN: protein binding, zinc ion binding; LOCATED IN: plasma membrane; EXPRESSED IN: 24 plant structures; EXPRESSED DURING: 15 growth stages; CONTAINS InterPro DOMAIN/s: Zinc finger, RING-type (InterPro:IPR001841), Zinc finger, RING/FYVE/PHD-type (InterPro:IPR013083); BEST Arabidopsis thaliana protein match is: zinc finger (C3HC4-type RING finger) family protein (TAIR:AT1G80400.1); Has 7180 Blast hits to 7160 proteins in 223 species: Archae - 0; Bacteria - 6; Metazoa - 2398; Fungi - 545; Plants - 2870; Viruses - 33; Other Eukaryotes - 1328 (source: NCBI BLink).	453	1	QQQQQQQ	7	100	7	1	432	438	95	LCKSEVGEKNSDLTSQGILTSLSSGENDNH	RSELRVENGLANNVI	GO:0005886:plasma membrane;	---	GO:0005515:protein binding;GO:0008270:zinc ion binding;GO:0046872:metal ion binding;	---
>prot|EG:AT3G03460.1-P|cod|AT3G03460.1-TAIR|gene|AT3G03460-TAIR-G|ann|unknown protein; unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: cellular_component unknown; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT5G17510.1); Has 19281 Blast hits to 8355 proteins in 385 species: Archae - 0; Bacteria - 328; Metazoa - 7312; Fungi - 1957; Plants - 1417; Viruses - 54; Other Eukaryotes - 8213 (source: NCBI BLink).	354	4	QMQQQQQMQQRQQQ	14	78.5714285714286	5	0.357142857142857	17	30	4	MEESKQQQLQQQQLLLQMQQQQQMQQRQQQ	LFLMQHLQKQQQQQAAMSMFPPNADAHLRP	GO:0005575:cellular_component;	GO:0008150:biological_process;	GO:0003674:molecular_function;	---
>prot|EG:AT3G03460.1-P|cod|AT3G03460.1-TAIR|gene|AT3G03460-TAIR-G|ann|unknown protein; unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: cellular_component unknown; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT5G17510.1); Has 19281 Blast hits to 8355 proteins in 385 species: Archae - 0; Bacteria - 328; Metazoa - 7312; Fungi - 1957; Plants - 1417; Viruses - 54; Other Eukaryotes - 8213 (source: NCBI BLink).	354	4	QKQQQQQ	7	85.7142857142857	5	0.714285714285714	38	44	10	QLQQQQLLLQMQQQQQMQQRQQQLFLMQHL	AAMSMFPPNADAHLRPPGLIPNRPVNPFLQ	GO:0005575:cellular_component;	GO:0008150:biological_process;	GO:0003674:molecular_function;	---
>prot|EG:AT3G03460.1-P|cod|AT3G03460.1-TAIR|gene|AT3G03460-TAIR-G|ann|unknown protein; unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: cellular_component unknown; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT5G17510.1); Has 19281 Blast hits to 8355 proteins in 385 species: Archae - 0; Bacteria - 328; Metazoa - 7312; Fungi - 1957; Plants - 1417; Viruses - 54; Other Eukaryotes - 8213 (source: NCBI BLink).	354	4	QQQQQQQ	7	100	7	1	90	96	25	PPGLIPNRPVNPFLQNVNPNPNLIQQANKF	MMMMMQQQQLQQQQQQKLMRPSNQLEIQFA	GO:0005575:cellular_component;	GO:0008150:biological_process;	GO:0003674:molecular_function;	---
>prot|EG:AT3G03460.1-P|cod|AT3G03460.1-TAIR|gene|AT3G03460-TAIR-G|ann|unknown protein; unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: cellular_component unknown; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT5G17510.1); Has 19281 Blast hits to 8355 proteins in 385 species: Archae - 0; Bacteria - 328; Metazoa - 7312; Fungi - 1957; Plants - 1417; Viruses - 54; Other Eukaryotes - 8213 (source: NCBI BLink).	354	4	QQQQLQQQQQQ	11	90.9090909090909	6	0.545454545454545	102	112	28	FLQNVNPNPNLIQQANKFQQQQQQQMMMMM	KLMRPSNQLEIQFAYQDAWRVCHPDFKRPF	GO:0005575:cellular_component;	GO:0008150:biological_process;	GO:0003674:molecular_function;	---
>prot|EG:AT5G28490.1-P|cod|AT5G28490.1-TAIR|gene|AT5G28490-TAIR-G|ann|LSH1 (LIGHT-DEPENDENT SHORT HYPOCOTYLS 1); Encodes a nuclear protein that mediates light regulation of seedling development in a phytochrome-dependent manner.	190	1	QLQQQQQQPQQGQ	13	76.9230769230769	6	0.461538461538462	167	179	87	RDFQAKARGVSYEKKRKRVNRQKPQTQPPL	SMMANYSGATV	GO:0005634:nucleus;	GO:0009416:response to light stimulus;GO:0009637:response to blue light;GO:0009826:unidimensional cell growth;GO:0010114:response to red light;GO:0010218:response to far red light;	GO:0003674:molecular_function;	---
>prot|EG:AT5G09620.1-P|cod|AT5G09620.1-TAIR|gene|AT5G09620-TAIR-G|ann|octicosapeptide/Phox/Bem1p (PB1) domain-containing protein; octicosapeptide/Phox/Bem1p (PB1) domain-containing protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: cellular_component unknown; EXPRESSED IN: 23 plant structures; EXPRESSED DURING: 13 growth stages; CONTAINS InterPro DOMAIN/s: Octicosapeptide/Phox/Bem1p (InterPro:IPR000270); BEST Arabidopsis thaliana protein match is: octicosapeptide/Phox/Bem1p (PB1) domain-containing protein (TAIR:AT5G64430.1); Has 17878 Blast hits to 10318 proteins in 471 species: Archae - 0; Bacteria - 445; Metazoa - 7320; Fungi - 1844; Plants - 1595; Viruses - 152; Other Eukaryotes - 6522 (source: NCBI BLink).	531	4	QQQQQQ	6	100	6	1	266	271	50	PAEIQRQIQEFQMIQIRDQEQQMLHQNQLH	EAIHQNQLHHQQEVIHQNQLLQQEAIHQNQ	GO:0005575:cellular_component;	GO:0008150:biological_process;	GO:0003674:molecular_function;	---
>prot|EG:AT5G09620.1-P|cod|AT5G09620.1-TAIR|gene|AT5G09620-TAIR-G|ann|octicosapeptide/Phox/Bem1p (PB1) domain-containing protein; octicosapeptide/Phox/Bem1p (PB1) domain-containing protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: cellular_component unknown; EXPRESSED IN: 23 plant structures; EXPRESSED DURING: 13 growth stages; CONTAINS InterPro DOMAIN/s: Octicosapeptide/Phox/Bem1p (InterPro:IPR000270); BEST Arabidopsis thaliana protein match is: octicosapeptide/Phox/Bem1p (PB1) domain-containing protein (TAIR:AT5G64430.1); Has 17878 Blast hits to 10318 proteins in 471 species: Archae - 0; Bacteria - 445; Metazoa - 7320; Fungi - 1844; Plants - 1595; Viruses - 152; Other Eukaryotes - 6522 (source: NCBI BLink).	531	4	QQQQQQ	6	100	6	1	304	309	57	IHQNQLHHQQEVIHQNQLLQQEAIHQNQML	EAMYRRKTEDEAGRYFPPTYTQNPAPVTNQ	GO:0005575:cellular_component;	GO:0008150:biological_process;	GO:0003674:molecular_function;	---
>prot|EG:AT5G09620.1-P|cod|AT5G09620.1-TAIR|gene|AT5G09620-TAIR-G|ann|octicosapeptide/Phox/Bem1p (PB1) domain-containing protein; octicosapeptide/Phox/Bem1p (PB1) domain-containing protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: cellular_component unknown; EXPRESSED IN: 23 plant structures; EXPRESSED DURING: 13 growth stages; CONTAINS InterPro DOMAIN/s: Octicosapeptide/Phox/Bem1p (InterPro:IPR000270); BEST Arabidopsis thaliana protein match is: octicosapeptide/Phox/Bem1p (PB1) domain-containing protein (TAIR:AT5G64430.1); Has 17878 Blast hits to 10318 proteins in 471 species: Archae - 0; Bacteria - 445; Metazoa - 7320; Fungi - 1844; Plants - 1595; Viruses - 152; Other Eukaryotes - 6522 (source: NCBI BLink).	531	4	QQQQQQQ	7	100	7	1	370	376	69	QPPVGYWQGNTNNSNIQGNIYTTTSQNLPE	VYMIPAQSQAPGTLYQSVMRPTVQGNQGYY	GO:0005575:cellular_component;	GO:0008150:biological_process;	GO:0003674:molecular_function;	---
>prot|EG:AT5G09620.1-P|cod|AT5G09620.1-TAIR|gene|AT5G09620-TAIR-G|ann|octicosapeptide/Phox/Bem1p (PB1) domain-containing protein; octicosapeptide/Phox/Bem1p (PB1) domain-containing protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: cellular_component unknown; EXPRESSED IN: 23 plant structures; EXPRESSED DURING: 13 growth stages; CONTAINS InterPro DOMAIN/s: Octicosapeptide/Phox/Bem1p (InterPro:IPR000270); BEST Arabidopsis thaliana protein match is: octicosapeptide/Phox/Bem1p (PB1) domain-containing protein (TAIR:AT5G64430.1); Has 17878 Blast hits to 10318 proteins in 471 species: Archae - 0; Bacteria - 445; Metazoa - 7320; Fungi - 1844; Plants - 1595; Viruses - 152; Other Eukaryotes - 6522 (source: NCBI BLink).	531	4	QPQQQQQQYQ	10	80	6	0.6	489	498	92	MGLQEPYSQMGKPVYYTVAGEGMMVQPPPA	GMGQPVSGMTDLRTGPDGKVAVNMAAPQVS	GO:0005575:cellular_component;	GO:0008150:biological_process;	GO:0003674:molecular_function;	---
>prot|EG:AT3G14180.1-P|cod|AT3G14180.1-TAIR|gene|AT3G14180-TAIR-G|ann|transcription factor; transcription factor; FUNCTIONS IN: transcription factor activity; INVOLVED IN: regulation of transcription; LOCATED IN: cellular_component unknown; EXPRESSED IN: 23 plant structures; EXPRESSED DURING: 13 growth stages; BEST Arabidopsis thaliana protein match is: ASIL1 (ARABIDOPSIS 6B-INTERACTING PROTEIN 1-LIKE 1); sequence-specific DNA binding / transcription factor (TAIR:AT1G54060.1); Has 259 Blast hits to 224 proteins in 23 species: Archae - 0; Bacteria - 0; Metazoa - 14; Fungi - 4; Plants - 220; Viruses - 0; Other Eukaryotes - 21 (source: NCBI BLink).	443	1	QQQQQ	5	100	5	1	281	285	63	NVPMGIPMSSRSAPFGQQGRTLPQQGRTLP	GMMVKRCSESKRWRFRKRNASDSDSESEAA	GO:0005575:cellular_component;	GO:0045449:regulation of transcription;	GO:0003677:DNA binding;GO:0003700:sequence-specific DNA binding transcription factor activity;	---
>prot|EG:AT2G01690.1-P|cod|AT2G01690.1-TAIR|gene|AT2G01690-TAIR-G|ann|binding; binding; FUNCTIONS IN: binding; INVOLVED IN: biological_process unknown; LOCATED IN: plasma membrane; EXPRESSED IN: 25 plant structures; EXPRESSED DURING: 13 growth stages; CONTAINS InterPro DOMAIN/s: HEAT (InterPro:IPR000357), Armadillo-like helical (InterPro:IPR011989), Armadillo-type fold (InterPro:IPR016024); Has 5822 Blast hits to 4096 proteins in 260 species: Archae - 0; Bacteria - 98; Metazoa - 2110; Fungi - 743; Plants - 135; Viruses - 11; Other Eukaryotes - 2725 (source: NCBI BLink).	743	1	QQQQQQQQQQQQQQQQ	16	100	16	1	697	712	93	LHRGQARTRVNYSYHSSSSSTSKEVRRSEE	RPPPSSTSSSVADNNRPPSRTSRKGPGQLQ	GO:0005886:plasma membrane;	GO:0008150:biological_process;	GO:0005488:binding;	---
>prot|EG:AT1G69420.2-P|cod|AT1G69420.2-TAIR|gene|AT1G69420-TAIR-G|ann|zinc finger (DHHC type) family protein; zinc finger (DHHC type) family protein; FUNCTIONS IN: zinc ion binding; INVOLVED IN: biological_process unknown; LOCATED IN: endomembrane system; EXPRESSED IN: 22 plant structures; EXPRESSED DURING: 13 growth stages; CONTAINS InterPro DOMAIN/s: Zinc finger, DHHC-type (InterPro:IPR001594); BEST Arabidopsis thaliana protein match is: zinc finger (DHHC type) family protein (TAIR:AT4G15080.1); Has 3791 Blast hits to 3785 proteins in 181 species: Archae - 0; Bacteria - 0; Metazoa - 1905; Fungi - 464; Plants - 413; Viruses - 0; Other Eukaryotes - 1009 (source: NCBI BLink).	596	1	QQRGQQQQQQ	10	80	6	0.6	551	560	92	SHDIHPFRVSSEAEDAAQLNGFSSAVGLMG	LSMMMMPLSRSTSDGYDASGGEDSDQVPSR	GO:0012505:endomembrane system;GO:0016020:membrane;GO:0016021:integral to membrane;	GO:0008150:biological_process;	GO:0005515:protein binding;GO:0008270:zinc ion binding;GO:0008415:acyltransferase activity;GO:0016740:transferase activity;GO:0046872:metal ion binding;	---
>prot|EG:AT2G03070.1-P|cod|AT2G03070.1-TAIR|gene|AT2G03070-TAIR-G|ann|unknown protein; unknown protein; LOCATED IN: cellular_component unknown; EXPRESSED IN: 21 plant structures; EXPRESSED DURING: 10 growth stages; Has 20753 Blast hits to 10362 proteins in 411 species: Archae - 2; Bacteria - 361; Metazoa - 8063; Fungi - 2482; Plants - 2165; Viruses - 54; Other Eukaryotes - 7626 (source: NCBI BLink).	524	3	QHQIQQQQFQQQQQ	14	78.5714285714286	5	0.357142857142857	295	308	56	PSGPNFDNTTSPLPYSNSPRATGMVNVPSP	RSKLMQLPQHQQQQLLAQQQQQLRQSSMQG	GO:0005575:cellular_component;	---	---	---
>prot|EG:AT2G03070.1-P|cod|AT2G03070.1-TAIR|gene|AT2G03070-TAIR-G|ann|unknown protein; unknown protein; LOCATED IN: cellular_component unknown; EXPRESSED IN: 21 plant structures; EXPRESSED DURING: 10 growth stages; Has 20753 Blast hits to 10362 proteins in 411 species: Archae - 2; Bacteria - 361; Metazoa - 8063; Fungi - 2482; Plants - 2165; Viruses - 54; Other Eukaryotes - 7626 (source: NCBI BLink).	524	3	QQQQQLRQ	8	75	5	0.625	326	333	62	HQIQQQQFQQQQQRSKLMQLPQHQQQQLLA	SSMQGLGQSQIPALHDMHGQAQQKFQTSHG	GO:0005575:cellular_component;	---	---	---
>prot|EG:AT2G03070.1-P|cod|AT2G03070.1-TAIR|gene|AT2G03070-TAIR-G|ann|unknown protein; unknown protein; LOCATED IN: cellular_component unknown; EXPRESSED IN: 21 plant structures; EXPRESSED DURING: 10 growth stages; Has 20753 Blast hits to 10362 proteins in 411 species: Archae - 2; Bacteria - 361; Metazoa - 8063; Fungi - 2482; Plants - 2165; Viruses - 54; Other Eukaryotes - 7626 (source: NCBI BLink).	524	3	QTQQTQIQQSQQQQQQQQQ	19	78.9473684210526	9	0.473684210526316	476	494	90	QQFGVSGTNPQRSHSSQMLGDQMFNTSGMM	GGYGNMQTNQQSLQPNNMMQNAQQRHQNPQ	GO:0005575:cellular_component;	---	---	---
>prot|EG:AT2G27050.1-P|cod|AT2G27050.1-TAIR|gene|AT2G27050-TAIR-G|ann|EIL1 (ETHYLENE-INSENSITIVE3-LIKE 1); transcription factor/ transcription regulator; ethylene-insensitive3-like1 (EIL1)	584	1	QQQQQQQQQ	9	100	9	1	570	578	97	QMVFDSTPFDMAAFDYRDDWQTGAMEGMGK	DVSIWF	GO:0005634:nucleus;	GO:0006350:transcription;GO:0009723:response to ethylene stimulus;GO:0009873:ethylene mediated signaling pathway;GO:0045449:regulation of transcription;	GO:0003677:DNA binding;GO:0003700:sequence-specific DNA binding transcription factor activity;GO:0030528:transcription regulator activity;	---
>prot|EG:AT3G15240.2-P|cod|AT3G15240.2-TAIR|gene|AT3G15240-TAIR-G|ann|unknown protein; unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: cellular_component unknown; EXPRESSED IN: root; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT5G53900.2); Has 145 Blast hits to 145 proteins in 22 species: Archae - 0; Bacteria - 0; Metazoa - 14; Fungi - 4; Plants - 125; Viruses - 0; Other Eukaryotes - 2 (source: NCBI BLink).	362	1	QNHQQQQQ	8	75	5	0.625	16	23	4	MVGSEHHHHHQQHHHQNHQQQQQRSKEALG	RSKEALGMVALHDALRTVCLNTDWTYSVFW	GO:0005575:cellular_component;	GO:0008150:biological_process;	GO:0003674:molecular_function;	---
>prot|EG:AT1G03370.1-P|cod|AT1G03370.1-TAIR|gene|AT1G03370-TAIR-G|ann|protein binding / zinc ion binding; protein binding / zinc ion binding; FUNCTIONS IN: protein binding, zinc ion binding; INVOLVED IN: biological_process unknown; LOCATED IN: cellular_component unknown; EXPRESSED IN: 23 plant structures; EXPRESSED DURING: 15 growth stages; CONTAINS InterPro DOMAIN/s: Zinc finger, RING-type (InterPro:IPR001841), C2 membrane targeting protein (InterPro:IPR018029), C2 calcium/lipid-binding region, CaLB (InterPro:IPR008973), GRAM (InterPro:IPR004182), C2 calcium-dependent membrane targeting (InterPro:IPR000008); BEST Arabidopsis thaliana protein match is: protein binding / zinc ion binding (TAIR:AT4G03000.2); Has 36666 Blast hits to 23729 proteins in 1173 species: Archae - 306; Bacteria - 2687; Metazoa - 20823; Fungi - 2509; Plants - 2020; Viruses - 91; Other Eukaryotes - 8230 (source: NCBI BLink).	1859	1	QQQQQ	5	100	5	1	1853	1857	99	QKRVTKNILVNLQDRLKMTFGFLEKEYSSR	VT	GO:0005575:cellular_component;GO:0008021:synaptic vesicle;GO:0016020:membrane;	GO:0006810:transport;GO:0008150:biological_process;	GO:0005215:transporter activity;GO:0005515:protein binding;GO:0008270:zinc ion binding;GO:0046872:metal ion binding;	---
>prot|EG:AT1G15780.1-P|cod|AT1G15780.1-TAIR|gene|AT1G15780-TAIR-G|ann|unknown protein; unknown protein; LOCATED IN: cellular_component unknown; EXPRESSED IN: 23 plant structures; EXPRESSED DURING: 15 growth stages; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT2G10440.2); Has 95200 Blast hits to 37450 proteins in 1266 species: Archae - 22; Bacteria - 4610; Metazoa - 36935; Fungi - 9504; Plants - 6357; Viruses - 312; Other Eukaryotes - 37460 (source: NCBI BLink).	1335	3	QQQQQ	5	100	5	1	220	224	16	QDSSGQHGLSSNMFSGPQRQMLGRPHAMSS	PYLYQQQLQQQLLKQNFQSGNVPNPNSLLP	GO:0005575:cellular_component;	GO:0006355:regulation of transcription, DNA-dependent;	GO:0003712:transcription cofactor activity;GO:0005515:protein binding;	---
>prot|EG:AT1G15780.1-P|cod|AT1G15780.1-TAIR|gene|AT1G15780-TAIR-G|ann|unknown protein; unknown protein; LOCATED IN: cellular_component unknown; EXPRESSED IN: 23 plant structures; EXPRESSED DURING: 15 growth stages; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT2G10440.2); Has 95200 Blast hits to 37450 proteins in 1266 species: Archae - 22; Bacteria - 4610; Metazoa - 36935; Fungi - 9504; Plants - 6357; Viruses - 312; Other Eukaryotes - 37460 (source: NCBI BLink).	1335	3	QQQQQ	5	100	5	1	258	262	19	YQQQLQQQLLKQNFQSGNVPNPNSLLPSHI	NVLQPNQLHSSQQPGVPTSATQPSTVNSAP	GO:0005575:cellular_component;	GO:0006355:regulation of transcription, DNA-dependent;	GO:0003712:transcription cofactor activity;GO:0005515:protein binding;	---
>prot|EG:AT1G15780.1-P|cod|AT1G15780.1-TAIR|gene|AT1G15780-TAIR-G|ann|unknown protein; unknown protein; LOCATED IN: cellular_component unknown; EXPRESSED IN: 23 plant structures; EXPRESSED DURING: 15 growth stages; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT2G10440.2); Has 95200 Blast hits to 37450 proteins in 1266 species: Archae - 22; Bacteria - 4610; Metazoa - 36935; Fungi - 9504; Plants - 6357; Viruses - 312; Other Eukaryotes - 37460 (source: NCBI BLink).	1335	3	QQQQQQQLQ	9	88.8888888888889	7	0.777777777777778	858	866	64	QHLKQQQDQQMQLKQQFQQRQMQQQQLQAR	ARQQAAQLQQMNDMNDLTSRQGMNVSRGMF	GO:0005575:cellular_component;	GO:0006355:regulation of transcription, DNA-dependent;	GO:0003712:transcription cofactor activity;GO:0005515:protein binding;	---
>prot|EG:AT1G79580.3-P|cod|AT1G79580.3-TAIR|gene|AT1G79580-TAIR-G|ann|SMB (SOMBRERO); transcription factor; NAC-domain protein. Involved in root cap development. Involved in a regulatory feedback loop with FEZ. FEZ activates SMB in hte root cap daughter cells soon after division, and SMB in turn represses FEZ expression in these cells, thereby preventing further stem cell divisions.	371	1	QQQQQQVQ	8	87.5	6	0.75	310	317	83	SQNLLRLTSNNNYGGDWSFLDKLLTTGNMN	NHQAKCFGDLSNNDNNDQADHLGNNNGGSS	GO:0005634:nucleus;	GO:0007275:multicellular organismal development;GO:0010455:positive regulation of cell fate commitment;GO:0045449:regulation of transcription;GO:0048829:root cap development;	GO:0003677:DNA binding;GO:0003700:sequence-specific DNA binding transcription factor activity;	---
>prot|EG:AT4G32551.1-P|cod|AT4G32551.1-TAIR|gene|AT4G32551-TAIR-G|ann|LUG (LEUNIG); protein binding / protein heterodimerization/ transcription repressor; LEUNIG regulates floral organ identity,gynoecium and ovule development. Negatively regulates AGAMOUS . Encodes a glutamine-rich protein with seven WD repeats similar to transcriptional corepressors.	931	4	QQQQQQQQQQIQMQQLLLQRAQQQQQQQQQQ	31	77.4193548387097	10	0.32258064516129	101	131	10	HSEVAASYIETQMIKAREQQLQQSQHPQVS	HHHHQQQQQQQQQQQQQQQQQQQQHQNQPP	GO:0005634:nucleus;	GO:0006350:transcription;GO:0007275:multicellular organismal development;GO:0009908:flower development;GO:0016481:negative regulation of transcription;GO:0030154:cell differentiation;GO:0045449:regulation of transcription;	GO:0003677:DNA binding;GO:0005515:protein binding;GO:0016564:transcription repressor activity;GO:0046982:protein heterodimerization activity;	---
>prot|EG:AT4G32551.1-P|cod|AT4G32551.1-TAIR|gene|AT4G32551-TAIR-G|ann|LUG (LEUNIG); protein binding / protein heterodimerization/ transcription repressor; LEUNIG regulates floral organ identity,gynoecium and ovule development. Negatively regulates AGAMOUS . Encodes a glutamine-rich protein with seven WD repeats similar to transcriptional corepressors.	931	4	QQQQQQQQQQQQQQQQQQQQHQNQ	24	91.6666666666667	20	0.833333333333333	136	159	14	QQQQQIQMQQLLLQRAQQQQQQQQQQHHHH	PPSQQQQQQSTPQHQQQPTPQQQPQRRDGS	GO:0005634:nucleus;	GO:0006350:transcription;GO:0007275:multicellular organismal development;GO:0009908:flower development;GO:0016481:negative regulation of transcription;GO:0030154:cell differentiation;GO:0045449:regulation of transcription;	GO:0003677:DNA binding;GO:0005515:protein binding;GO:0016564:transcription repressor activity;GO:0046982:protein heterodimerization activity;	---
>prot|EG:AT4G32551.1-P|cod|AT4G32551.1-TAIR|gene|AT4G32551-TAIR-G|ann|LUG (LEUNIG); protein binding / protein heterodimerization/ transcription repressor; LEUNIG regulates floral organ identity,gynoecium and ovule development. Negatively regulates AGAMOUS . Encodes a glutamine-rich protein with seven WD repeats similar to transcriptional corepressors.	931	4	QQQQQQQQQQQQQQQQQQQQHQNQPPSQQQQQQ	33	84.8484848484848	20	0.606060606060606	136	168	14	QQQQQIQMQQLLLQRAQQQQQQQQQQHHHH	STPQHQQQPTPQQQPQRRDGSHLANGSANG	GO:0005634:nucleus;	GO:0006350:transcription;GO:0007275:multicellular organismal development;GO:0009908:flower development;GO:0016481:negative regulation of transcription;GO:0030154:cell differentiation;GO:0045449:regulation of transcription;	GO:0003677:DNA binding;GO:0005515:protein binding;GO:0016564:transcription repressor activity;GO:0046982:protein heterodimerization activity;	---
>prot|EG:AT4G32551.1-P|cod|AT4G32551.1-TAIR|gene|AT4G32551-TAIR-G|ann|LUG (LEUNIG); protein binding / protein heterodimerization/ transcription repressor; LEUNIG regulates floral organ identity,gynoecium and ovule development. Negatively regulates AGAMOUS . Encodes a glutamine-rich protein with seven WD repeats similar to transcriptional corepressors.	931	4	QQQQQNQQQ	9	88.8888888888889	5	0.555555555555556	449	457	48	PNVGSSLQPGGSLLPRGDTDMLLKLKMALL	GGGNPPQPQPQPQPLNQLALTNPQPQSSNH	GO:0005634:nucleus;	GO:0006350:transcription;GO:0007275:multicellular organismal development;GO:0009908:flower development;GO:0016481:negative regulation of transcription;GO:0030154:cell differentiation;GO:0045449:regulation of transcription;	GO:0003677:DNA binding;GO:0005515:protein binding;GO:0016564:transcription repressor activity;GO:0046982:protein heterodimerization activity;	---
>prot|EG:AT1G56170.2-P|cod|AT1G56170.2-TAIR|gene|AT1G56170-TAIR-G|ann|NF-YC2 (NUCLEAR FACTOR Y, SUBUNIT C2); DNA binding / transcription activator/ transcription factor; Encodes a protein with similarity to a subunit of the CCAAT promoter motif binding complex of yeast.One of two members of this class (HAP5B) and expressed in vegetative and reproductive tissues	199	2	QQQQQQ	6	100	6	1	8	13	4	MEQSEEGQQQQQQGVMDYVPPHAYQSGPVN	GVMDYVPPHAYQSGPVNAASHMAFQQAHHF	GO:0005622:intracellular;GO:0005634:nucleus;GO:0005737:cytoplasm;GO:0016602:CCAAT-binding factor complex;	GO:0006350:transcription;GO:0006355:regulation of transcription, DNA-dependent;GO:0043193:positive regulation of gene-specific transcription;GO:0045449:regulation of transcription;	GO:0003677:DNA binding;GO:0003700:sequence-specific DNA binding transcription factor activity;GO:0016563:transcription activator activity;GO:0043565:sequence-specific DNA binding;	---
>prot|EG:AT1G56170.2-P|cod|AT1G56170.2-TAIR|gene|AT1G56170-TAIR-G|ann|NF-YC2 (NUCLEAR FACTOR Y, SUBUNIT C2); DNA binding / transcription activator/ transcription factor; Encodes a protein with similarity to a subunit of the CCAAT promoter motif binding complex of yeast.One of two members of this class (HAP5B) and expressed in vegetative and reproductive tissues	199	2	QQQQQQQLQ	9	88.8888888888889	7	0.777777777777778	48	56	24	YVPPHAYQSGPVNAASHMAFQQAHHFHHHH	MFWANQMQEIEHTTDFKNHTLPLARIKKIM	GO:0005622:intracellular;GO:0005634:nucleus;GO:0005737:cytoplasm;GO:0016602:CCAAT-binding factor complex;	GO:0006350:transcription;GO:0006355:regulation of transcription, DNA-dependent;GO:0043193:positive regulation of gene-specific transcription;GO:0045449:regulation of transcription;	GO:0003677:DNA binding;GO:0003700:sequence-specific DNA binding transcription factor activity;GO:0016563:transcription activator activity;GO:0043565:sequence-specific DNA binding;	---
>prot|EG:AT1G21740.1-P|cod|AT1G21740.1-TAIR|gene|AT1G21740-TAIR-G|ann|unknown protein; unknown protein; INVOLVED IN: N-terminal protein myristoylation; EXPRESSED IN: 10 plant structures; EXPRESSED DURING: F mature embryo stage, petal differentiation and expansion stage, D bilateral stage, E expanded cotyledon stage; CONTAINS InterPro DOMAIN/s: Protein of unknown function DUF630 (InterPro:IPR006868), Protein of unknown function DUF632 (InterPro:IPR006867); BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT1G77500.1); Has 1095 Blast hits to 940 proteins in 150 species: Archae - 5; Bacteria - 44; Metazoa - 449; Fungi - 64; Plants - 357; Viruses - 0; Other Eukaryotes - 176 (source: NCBI BLink).	953	1	QQQQQ	5	100	5	1	944	948	99	SSLQAGLVPIFEALGNFTSQVVKAHEDVRF	PESED	---	---	---	---
>prot|EG:AT3G26990.1-P|cod|AT3G26990.1-TAIR|gene|AT3G26990-TAIR-G|ann|unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: endomembrane system; EXPRESSED IN: 24 plant structures; EXPRESSED DURING: 13 growth stages; CONTAINS InterPro DOMAIN/s: Protein of unknown function DUF618 (InterPro:IPR006903), Regulation of nuclear pre-mRNA protein (InterPro:IPR006569), ENTH/VHS (InterPro:IPR008942); BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT5G10060.1); Has 815 Blast hits to 806 proteins in 138 species: Archae - 0; Bacteria - 10; Metazoa - 490; Fungi - 159; Plants - 81; Viruses - 1; Other Eukaryotes - 74 (source: NCBI BLink).	513	1	QQQQQEQ	7	85.7142857142857	5	0.714285714285714	462	468	90	QPQFLQPLQPPGPVNHTPFNYTIATSTATT	GPWVPGLTQLSTTSAPSENSYQKFQGQDGF	GO:0012505:endomembrane system;	GO:0008150:biological_process;	GO:0003674:molecular_function;	---
>prot|EG:AT1G28310.1-P|cod|AT1G28310.1-TAIR|gene|AT1G28310-TAIR-G|ann|Dof-type zinc finger domain-containing protein; Dof-type zinc finger domain-containing protein; FUNCTIONS IN: transcription factor activity, DNA binding; INVOLVED IN: regulation of transcription; CONTAINS InterPro DOMAIN/s: Zinc finger, Dof-type (InterPro:IPR003851); BEST Arabidopsis thaliana protein match is: Dof-type zinc finger domain-containing protein (TAIR:AT5G02460.1); Has 945 Blast hits to 838 proteins in 78 species: Archae - 0; Bacteria - 20; Metazoa - 141; Fungi - 16; Plants - 623; Viruses - 0; Other Eukaryotes - 145 (source: NCBI BLink).	311	1	QQQQQQQPQQPQPQ	14	78.5714285714286	7	0.5	13	26	4	MQSKNMIVASSHQQQQQQQPQQPQPQLKCP	LKCPRCDSSNTKFCYYNNYSLSQPRHFCKA	GO:0005634:nucleus;	GO:0006350:transcription;GO:0045449:regulation of transcription;	GO:0003677:DNA binding;GO:0003700:sequence-specific DNA binding transcription factor activity;GO:0008270:zinc ion binding;GO:0046872:metal ion binding;	---
>prot|EG:AT1G58110.2-P|cod|AT1G58110.2-TAIR|gene|AT1G58110-TAIR-G|ann|bZIP family transcription factor; bZIP family transcription factor; FUNCTIONS IN: transcription factor activity, sequence-specific DNA binding, DNA binding; INVOLVED IN: regulation of transcription, DNA-dependent; LOCATED IN: cellular_component unknown; EXPRESSED IN: 23 plant structures; EXPRESSED DURING: 13 growth stages; CONTAINS InterPro DOMAIN/s: Basic-leucine zipper (bZIP) transcription factor (InterPro:IPR004827); BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT4G06598.1); Has 469 Blast hits to 465 proteins in 74 species: Archae - 0; Bacteria - 2; Metazoa - 56; Fungi - 20; Plants - 358; Viruses - 0; Other Eukaryotes - 33 (source: NCBI BLink).	374	1	QQQQQTQ	7	85.7142857142857	5	0.714285714285714	325	331	86	RLESIAQEKLIKQLEQEVLEKEIGRLRALY	KPSASRGRATSKDLDSQFSSLSLNTKDSNC	GO:0005575:cellular_component;	GO:0006355:regulation of transcription, DNA-dependent;	GO:0003677:DNA binding;GO:0003700:sequence-specific DNA binding transcription factor activity;GO:0005515:protein binding;GO:0043565:sequence-specific DNA binding;	---
>prot|EG:AT1G28310.2-P|cod|AT1G28310.2-TAIR|gene|AT1G28310-TAIR-G|ann|Dof-type zinc finger domain-containing protein; Dof-type zinc finger domain-containing protein; FUNCTIONS IN: transcription factor activity, DNA binding; INVOLVED IN: regulation of transcription; CONTAINS InterPro DOMAIN/s: Zinc finger, Dof-type (InterPro:IPR003851); BEST Arabidopsis thaliana protein match is: Dof-type zinc finger domain-containing protein (TAIR:AT5G02460.1); Has 945 Blast hits to 838 proteins in 78 species: Archae - 0; Bacteria - 20; Metazoa - 141; Fungi - 16; Plants - 623; Viruses - 0; Other Eukaryotes - 145 (source: NCBI BLink).	325	1	QQQQQQQPQQPQPQ	14	78.5714285714286	7	0.5	27	40	8	MPIISSPNTNPLASMQSKNMIVASSHQQQQ	LKCPRCDSSNTKFCYYNNYSLSQPRHFCKA	GO:0005634:nucleus;	GO:0006350:transcription;GO:0045449:regulation of transcription;	GO:0003677:DNA binding;GO:0003700:sequence-specific DNA binding transcription factor activity;GO:0008270:zinc ion binding;GO:0046872:metal ion binding;	---
>prot|EG:AT2G26920.1-P|cod|AT2G26920.1-TAIR|gene|AT2G26920-TAIR-G|ann|ubiquitin-associated (UBA)/TS-N domain-containing protein; ubiquitin-associated (UBA)/TS-N domain-containing protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: chloroplast; EXPRESSED IN: 24 plant structures; EXPRESSED DURING: 15 growth stages; CONTAINS InterPro DOMAIN/s: Ubiquitin-associated/translation elongation factor EF1B, N-terminal (InterPro:IPR000449), Ubiquitin-associated/translation elongation factor EF1B, N-terminal, eukaryote (InterPro:IPR015940), UBA-like (InterPro:IPR009060); BEST Arabidopsis thaliana protein match is: ubiquitin-associated (UBA)/TS-N domain-containing protein (TAIR:AT5G12120.1); Has 357 Blast hits to 347 proteins in 77 species: Archae - 0; Bacteria - 14; Metazoa - 137; Fungi - 59; Plants - 26; Viruses - 1; Other Eukaryotes - 120 (source: NCBI BLink).	646	1	QQQQQQ	6	100	6	1	398	403	61	SLPSSPSPSPQPAVRVEARYLASGNEFKNF	PANRESVMVMRQRPQVVITNPVPTSSMSAP	GO:0009507:chloroplast;	GO:0008150:biological_process;	GO:0003674:molecular_function;	---
>prot|EG:AT1G29160.1-P|cod|AT1G29160.1-TAIR|gene|AT1G29160-TAIR-G|ann|Dof-type zinc finger domain-containing protein; Dof-type zinc finger domain-containing protein; FUNCTIONS IN: transcription factor activity, DNA binding; INVOLVED IN: regulation of transcription; LOCATED IN: cellular_component unknown; EXPRESSED IN: 22 plant structures; EXPRESSED DURING: 13 growth stages; CONTAINS InterPro DOMAIN/s: Zinc finger, Dof-type (InterPro:IPR003851); BEST Arabidopsis thaliana protein match is: Dof-type zinc finger domain-containing protein (TAIR:AT2G34140.1); Has 618 Blast hits to 614 proteins in 41 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 613; Viruses - 0; Other Eukaryotes - 5 (source: NCBI BLink).	175	1	QQQQQQ	6	100	6	1	31	36	17	MATQDSQGIKLFGKTITFNANITQTIKKEE	PELQATTAVRSPSSDLTAEKRPDKIIPCPR	GO:0005575:cellular_component;GO:0005634:nucleus;	GO:0006350:transcription;GO:0045449:regulation of transcription;	GO:0003677:DNA binding;GO:0003700:sequence-specific DNA binding transcription factor activity;GO:0008270:zinc ion binding;GO:0046872:metal ion binding;	---
>prot|EG:AT1G20900.1-P|cod|AT1G20900.1-TAIR|gene|AT1G20900-TAIR-G|ann|ESC (ESCAROLA); double-stranded DNA binding; Encodes an AT hook domain containing protein that acts redundantly with SOB3 to modulate hypocotyl growth inhibition in response to light.	311	1	QHQQHQQQQQ	10	80	5	0.5	43	52	13	RYFHNLFRPEIHHQQLQPQGGINLIDQHHH	PSDDSRESDHSNKDHHQQGRPDSDPNTSSS	GO:0000785:chromatin;GO:0005634:nucleus;GO:0016020:membrane;	GO:0006325:chromatin organization;GO:0006355:regulation of transcription, DNA-dependent;GO:0009640:photomorphogenesis;GO:0010150:leaf senescence;GO:0051260:protein homooligomerization;	GO:0003677:DNA binding;GO:0003690:double-stranded DNA binding;	---
>prot|EG:AT1G65270.3-P|cod|AT1G65270.3-TAIR|gene|AT1G65270-TAIR-G|ann|unknown protein; unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: endoplasmic reticulum, plasma membrane; EXPRESSED IN: 24 plant structures; EXPRESSED DURING: 13 growth stages; Has 116 Blast hits to 116 proteins in 39 species: Archae - 0; Bacteria - 0; Metazoa - 88; Fungi - 0; Plants - 26; Viruses - 0; Other Eukaryotes - 2 (source: NCBI BLink).	292	1	QQQQQ	5	100	5	1	54	58	18	DELLVDDDEFGLEGAKPRSTDLYTSSSSSP	TPTIRRRYSDPTDLDSKVQFTLEHAFGDSD	GO:0005783:endoplasmic reticulum;GO:0005886:plasma membrane;	GO:0008150:biological_process;	GO:0003674:molecular_function;	---
>prot|EG:AT1G75520.1-P|cod|AT1G75520.1-TAIR|gene|AT1G75520-TAIR-G|ann|SRS5 (SHI-RELATED SEQUENCE 5); A member of SHI gene family. Arabidopsis thaliana has ten members that encode proteins with a RING finger-like zinc finger motif. Despite being highly divergent in sequence, many of the SHI-related genes are partially redundant in function and synergistically promote gynoecium, stamen and leaf development in Arabidopsis.	346	1	QYFQQQEHQQQQQQQQ	16	75	8	0.5	57	72	16	DHHHQDKSNYLYLYKDEIYNNNKGFEIWPP	HASAPANFYSFGMVPSGSSSNNNNNRSRSL	GO:0005575:cellular_component;	GO:0048467:gynoecium development;	GO:0003674:molecular_function;	---
>prot|EG:AT3G22104.1-P|cod|AT3G22104.1-TAIR|gene|AT3G22104-TAIR-G|ann|phototropic-responsive NPH3 protein-related; phototropic-responsive NPH3 protein-related; FUNCTIONS IN: protein binding, signal transducer activity; INVOLVED IN: response to light stimulus; EXPRESSED IN: 20 plant structures; EXPRESSED DURING: 13 growth stages; CONTAINS InterPro DOMAIN/s: NPH3 (InterPro:IPR004249), BTB/POZ fold (InterPro:IPR011333), BTB/POZ-like (InterPro:IPR000210); BEST Arabidopsis thaliana protein match is: phototropic-responsive NPH3 family protein (TAIR:AT3G19850.1); Has 443 Blast hits to 434 proteins in 27 species: Archae - 0; Bacteria - 4; Metazoa - 28; Fungi - 3; Plants - 386; Viruses - 0; Other Eukaryotes - 22 (source: NCBI BLink).	506	1	QQQQQQQQQQQKQ	13	92.3076923076923	11	0.846153846153846	429	441	84	RTLSYEKLSGESRAHISRNQKFQAIETLDE	LILRMEKVETSGENEKLKEHIEGIQWRVME	---	GO:0009416:response to light stimulus;	GO:0004871:signal transducer activity;GO:0004872:receptor activity;GO:0005515:protein binding;	---
>prot|EG:AT5G18440.2-P|cod|AT5G18440.2-TAIR|gene|AT5G18440-TAIR-G|ann|unknown protein; unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; EXPRESSED IN: 22 plant structures; EXPRESSED DURING: 13 growth stages; Has 1233 Blast hits to 1114 proteins in 157 species: Archae - 0; Bacteria - 93; Metazoa - 319; Fungi - 137; Plants - 52; Viruses - 6; Other Eukaryotes - 626 (source: NCBI BLink).	470	1	QHQLQQQQQ	9	77.7777777777778	5	0.555555555555556	18	26	3	MRPPYNSFQPQARPYRPQHQLQQQQQINGF	INGFSNHQQQQHNGYQNPMNANQLGMMNPQ	---	GO:0008150:biological_process;	GO:0003674:molecular_function;	---
>prot|EG:AT2G20880.1-P|cod|AT2G20880.1-TAIR|gene|AT2G20880-TAIR-G|ann|AP2 domain-containing transcription factor, putative; AP2 domain-containing transcription factor, putative; FUNCTIONS IN: transcription factor activity, DNA binding; INVOLVED IN: regulation of transcription, DNA-dependent; LOCATED IN: nucleus, cytoplasm; EXPRESSED IN: stamen; EXPRESSED DURING: 4 anthesis, petal differentiation and expansion stage; CONTAINS InterPro DOMAIN/s: DNA-binding, integrase-type (InterPro:IPR016177), Pathogenesis-related transcriptional factor and ERF, DNA-binding (InterPro:IPR001471); BEST Arabidopsis thaliana protein match is: AP2 domain-containing transcription factor, putative (TAIR:AT4G28140.1); Has 3873 Blast hits to 3741 proteins in 208 species: Archae - 0; Bacteria - 2; Metazoa - 6; Fungi - 2; Plants - 3838; Viruses - 2; Other Eukaryotes - 23 (source: NCBI BLink).	336	1	QQQQQQQ	7	100	7	1	135	141	40	RFLHPNDPSGQRQQQMISFDPQQQVQPYVA	HLLQYWRDILKLSPSGRMMMMNMLRQESDL	GO:0005634:nucleus;GO:0005737:cytoplasm;	GO:0006350:transcription;GO:0006355:regulation of transcription, DNA-dependent;GO:0009873:ethylene mediated signaling pathway;GO:0045449:regulation of transcription;	GO:0003677:DNA binding;GO:0003700:sequence-specific DNA binding transcription factor activity;	---
>prot|EG:AT1G32240.1-P|cod|AT1G32240.1-TAIR|gene|AT1G32240-TAIR-G|ann|KAN2 (KANADI 2); DNA binding / transcription factor; Encodes a member of the KANADI family of putative transcription factors. Together with KAN1, this gene appears to be involved in the development of the carpel and the outer integument of the ovule.Along with KAN1 and KAN4 appears to regulate the proper localization of PIN1 in early embryogenesis.	388	2	QQQQQ	5	100	5	1	81	85	20	SRTSSLVSNSTSKTINHPFQDLSLSNISHH	HHHPQLLPNCNSSNILTSFQFPTQQQQQHL	---	GO:0009944:polarity specification of adaxial/abaxial axis;GO:0045449:regulation of transcription;GO:0048440:carpel development;GO:0048481:ovule development;	GO:0003677:DNA binding;GO:0003700:sequence-specific DNA binding transcription factor activity;	---
>prot|EG:AT1G32240.1-P|cod|AT1G32240.1-TAIR|gene|AT1G32240-TAIR-G|ann|KAN2 (KANADI 2); DNA binding / transcription factor; Encodes a member of the KANADI family of putative transcription factors. Together with KAN1, this gene appears to be involved in the development of the carpel and the outer integument of the ovule.Along with KAN1 and KAN4 appears to regulate the proper localization of PIN1 in early embryogenesis.	388	2	QQQQQHLQ	8	75	5	0.625	109	116	28	HHQQQQQHHHPQLLPNCNSSNILTSFQFPT	GFLAHDLNTHLRPIRGIPLYHNPPPHHHPH	---	GO:0009944:polarity specification of adaxial/abaxial axis;GO:0045449:regulation of transcription;GO:0048440:carpel development;GO:0048481:ovule development;	GO:0003677:DNA binding;GO:0003700:sequence-specific DNA binding transcription factor activity;	---
>prot|EG:AT5G32293.1-P|cod|AT5G32293.1-TAIR|gene|AT5G32293-TAIR-G|ann|transposable element gene; gypsy-like retrotransposon family (Athila), has a 1.2e-314 P-value blast match to GB:CAA57397 Athila ORF 1 (Arabidopsis thaliana)	911	1	QQQQQ	5	100	5	1	392	396	43	FVPYNQGQGYVPKQQYQGNYQQKLPPPGFT	PASTTPDSDLKNMLQQILQGQAAGAMDLAK	GO:0005575:cellular_component;	GO:0006508:proteolysis;GO:0008150:biological_process;	GO:0003674:molecular_function;GO:0004190:aspartic-type endopeptidase activity;	---
>prot|EG:AT5G66870.1-P|cod|AT5G66870.1-TAIR|gene|AT5G66870-TAIR-G|ann|ASL1; Encodes LOB domain protein whose overexpression results in KNOX gene repression. Overexpression also results in plants with hyponastic leaves, downward pointing flowers and reduced apical dominance. May be involved in the transcriptional regulation of the homeobox gene BP (brevipedicellus) during lateral organ differentiation. Acts together with AS2 in proximal-distal symmetry determination.	313	1	QQQQQ	5	100	5	1	163	167	52	RPSSSSASVLTQHHHNLLPMMAIPTGQLYH	IFEAQQLAAVAREQQNEMFRAYGGGGGSSS	GO:0005575:cellular_component;	GO:0007275:multicellular organismal development;GO:0009954:proximal/distal pattern formation;GO:0009965:leaf morphogenesis;GO:0045449:regulation of transcription;GO:0048441:petal development;	---	---
>prot|EG:AT3G48590.1-P|cod|AT3G48590.1-TAIR|gene|AT3G48590-TAIR-G|ann|NF-YC1 (NUCLEAR FACTOR Y, SUBUNIT C1); DNA binding / transcription activator/ transcription factor; Encodes a protein with similarity to a subunit of the CCAAT promoter motif binding complex of yeast.One of two members of this class (HAP5A) and expressed in vegetative and reproductive tissues.	234	1	QQQQQQLQ	8	87.5	6	0.75	38	45	16	PPPSAAGIPPPPPGTTISAAGGGASYHHLL	LFWTYQRQEIEQVNDFKNHQLPLARIKKIM	GO:0005622:intracellular;GO:0005634:nucleus;GO:0016602:CCAAT-binding factor complex;	GO:0006350:transcription;GO:0006355:regulation of transcription, DNA-dependent;GO:0043193:positive regulation of gene-specific transcription;GO:0045449:regulation of transcription;	GO:0003677:DNA binding;GO:0003700:sequence-specific DNA binding transcription factor activity;GO:0016563:transcription activator activity;GO:0043565:sequence-specific DNA binding;	---
>prot|EG:AT3G05680.1-P|cod|AT3G05680.1-TAIR|gene|AT3G05680-TAIR-G|ann|EMB2016 (embryo defective 2016); embryo defective 2016 (EMB2016); FUNCTIONS IN: molecular_function unknown; INVOLVED IN: embryonic development ending in seed dormancy; LOCATED IN: cellular_component unknown; Has 7710 Blast hits to 5348 proteins in 349 species: Archae - 0; Bacteria - 146; Metazoa - 3422; Fungi - 1120; Plants - 652; Viruses - 71; Other Eukaryotes - 2299 (source: NCBI BLink).	2138	1	QVQQQQQ	7	85.7142857142857	5	0.714285714285714	2069	2075	96	PFQIPMHQMQLMQQTQVQPYYHPPQQQEIS	HHAVQGQQGAGTSQQQESGMSLHDYFKSPE	GO:0005575:cellular_component;	GO:0009793:embryo development ending in seed dormancy;	GO:0003674:molecular_function;	---
>prot|EG:AT5G66350.1-P|cod|AT5G66350.1-TAIR|gene|AT5G66350-TAIR-G|ann|SHI (SHORT INTERNODES); protein binding / protein heterodimerization/ transcription factor; A member of SHI gene family. Arabidopsis thaliana has ten members that encode proteins with a RING finger-like zinc finger motif. Despite being highly divergent in sequence, many of the SHI-related genes are partially redundant in function and synergistically promote gynoecium, stamen and leaf development in Arabidopsis. Shi mutant is dominant, has dwarf phenotype. Loss of function mutations have no observable phenotype. Putative zinc finger protein. Involved in the response to gibberellic acid.	331	1	QQQQQQQQ	8	100	8	1	71	78	21	NSNADGGEAGPSYKGTLELWQHPNNQEIIF	RLDLYTSAAGLGVGPSNRSLIETSGGALMM	GO:0005634:nucleus;	GO:0009739:response to gibberellin stimulus;GO:0009740:gibberellic acid mediated signaling pathway;	GO:0003700:sequence-specific DNA binding transcription factor activity;GO:0005515:protein binding;GO:0046982:protein heterodimerization activity;	---
>prot|EG:AT2G03710.1-P|cod|AT2G03710.1-TAIR|gene|AT2G03710-TAIR-G|ann|SEP4 (SEPALLATA 4); DNA binding / transcription factor; This gene belongs to the family of SEP genes. It is involved in the development of sepals, petals, stamens and carpels. Additionally, it plays a central role in the determination of flower meristem and organ identity.	258	1	QQQQHQQQQQ	10	90	5	0.5	191	200	74	LLETNRDLRRKLEDSDAALTQSFWGSSAAE	GMSSYQSNPPIQEAGFFKPLQGNVALQMSS	GO:0005634:nucleus;	GO:0006350:transcription;GO:0006355:regulation of transcription, DNA-dependent;GO:0010076:maintenance of floral meristem identity;GO:0045449:regulation of transcription;GO:0048440:carpel development;GO:0048441:petal development;GO:0048442:sepal development;GO:0048443:stamen development;	GO:0003677:DNA binding;GO:0003700:sequence-specific DNA binding transcription factor activity;GO:0005515:protein binding;GO:0043565:sequence-specific DNA binding;	---
>prot|EG:AT1G06040.2-P|cod|AT1G06040.2-TAIR|gene|AT1G06040-TAIR-G|ann|STO (SALT TOLERANCE); DNA binding / protein binding / transcription factor/ zinc ion binding; Encodes salt tolerance protein (STO) which confers salt tolerance to yeast cells. Fully complements calcineurin deficient yeast but does not encode a phosphoprotein phosphatase. Sequence has similarities to CONSTANS. STO co-localizes with COP1 and plays a role in light signaling.	177	1	QQQQQ	5	100	5	1	139	143	78	TICSKEIEKNQPEPSNNQQKANQIPAKSTS	PSSATPLPWAVDDFFHFSDIESTDKVVMRI	GO:0005575:cellular_component;GO:0005622:intracellular;GO:0005634:nucleus;	GO:0006414:translational elongation;GO:0009416:response to light stimulus;GO:0009640:photomorphogenesis;GO:0009651:response to salt stress;	GO:0003677:DNA binding;GO:0003700:sequence-specific DNA binding transcription factor activity;GO:0005515:protein binding;GO:0008270:zinc ion binding;GO:0030533:triplet codon-amino acid adaptor activity;GO:0046872:metal ion binding;	---
>prot|EG:AT5G28640.1-P|cod|AT5G28640.1-TAIR|gene|AT5G28640-TAIR-G|ann|AN3 (ANGUSTIFOLIA 3); protein binding / transcription coactivator; Encodes a protein with similarity to mammalian transcriptional coactivator that is involved in cell proliferation during leaf and flower development. Loss of function mutations have narrow, pointed leaves and narrow floral organs. AN3 interacts with members of the growth regulating factor (GRF) family of transcription factors.	210	1	QQQQQQQ	7	100	7	1	126	132	60	SHYLQQQQATQQQQMTQQSLMAARSSMLYA	PYATLQHQQLHHSQLGMSSSSGGGGSSGLH	GO:0005575:cellular_component;	GO:0008283:cell proliferation;GO:0048366:leaf development;	GO:0003713:transcription coactivator activity;GO:0005515:protein binding;	---
>prot|EG:AT2G18750.2-P|cod|AT2G18750.2-TAIR|gene|AT2G18750-TAIR-G|ann|calmodulin-binding protein; calmodulin-binding protein; FUNCTIONS IN: calmodulin binding; INVOLVED IN: biological_process unknown; LOCATED IN: cellular_component unknown; EXPRESSED IN: 22 plant structures; EXPRESSED DURING: 13 growth stages; CONTAINS InterPro DOMAIN/s: Calmodulin binding protein-like (InterPro:IPR012416); BEST Arabidopsis thaliana protein match is: calmodulin-binding protein (TAIR:AT5G57580.1); Has 187 Blast hits to 180 proteins in 13 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 187; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink).	622	1	QQQQQQ	6	100	6	1	24	29	3	MQTRYMERTNSMREKRKLEEDDNQQQQQQP	PERKRPALASVIVEALKMDSLQRLCSSLEP	GO:0005575:cellular_component;	GO:0008150:biological_process;	GO:0005516:calmodulin binding;	---
>prot|EG:AT2G01930.2-P|cod|AT2G01930.2-TAIR|gene|AT2G01930-TAIR-G|ann|BPC1 (BASIC PENTACYSTEINE1); DNA binding / specific transcriptional repressor/ transcription factor; BASIC PENTACYSTEINE1 (BPC1) is a regulator of the homeotic Arabidopsis thaliana gene SEEDSTICK (STK), which controls ovule identity. BPC1 induces conformational changes by cooperative binding to purine-rich elements present in the STK regulatory sequence. STK is upregulated in bpc1 mutant.	283	1	QQQQQ	5	100	5	1	163	167	57	MRGSIATPTVPKAKKMRKPKEERDVTNNNV	RVKPVKKSVDLVINGVSMDISGLPVPVCTC	GO:0005634:nucleus;	GO:0006355:regulation of transcription, DNA-dependent;	GO:0003677:DNA binding;GO:0003700:sequence-specific DNA binding transcription factor activity;GO:0016566:specific transcriptional repressor activity;	---
>prot|EG:AT2G23070.1-P|cod|AT2G23070.1-TAIR|gene|AT2G23070-TAIR-G|ann|casein kinase II alpha chain, putative; casein kinase II alpha chain, putative; FUNCTIONS IN: protein serine/threonine kinase activity, protein kinase activity, kinase activity, ATP binding; INVOLVED IN: protein amino acid phosphorylation; LOCATED IN: chloroplast; EXPRESSED IN: 24 plant structures; EXPRESSED DURING: 15 growth stages; CONTAINS InterPro DOMAIN/s: Protein kinase, ATP binding site (InterPro:IPR017441), Protein kinase, core (InterPro:IPR000719), Serine/threonine protein kinase (InterPro:IPR002290), Serine/threonine protein kinase-related (InterPro:IPR017442), Protein kinase-like (InterPro:IPR011009), Serine/threonine protein kinase, active site (InterPro:IPR008271); BEST Arabidopsis thaliana protein match is: CKA2 (CASEIN KINASE II, ALPHA CHAIN 2); kinase (TAIR:AT3G50000.1); Has 64751 Blast hits to 64057 proteins in 1615 species: Archae - 32; Bacteria - 5455; Metazoa - 28404; Fungi - 7544; Plants - 8636; Viruses - 332; Other Eukaryotes - 14348 (source: NCBI BLink).	432	1	QQQQHQQQQQ	10	90	5	0.5	66	75	15	AKRNLLLSSLQDNLRRFASSASLYRQHLRN	SRVKEKSETLAQKIGKSIRRAGAPSKARVY	GO:0009507:chloroplast;	GO:0006468:protein amino acid phosphorylation;	GO:0000166:nucleotide binding;GO:0004672:protein kinase activity;GO:0004674:protein serine/threonine kinase activity;GO:0004713:protein tyrosine kinase activity;GO:0005524:ATP binding;GO:0016301:kinase activity;	---
>prot|EG:AT5G52510.1-P|cod|AT5G52510.1-TAIR|gene|AT5G52510-TAIR-G|ann|scarecrow-like transcription factor 8 (SCL8); scarecrow-like transcription factor 8 (SCL8); FUNCTIONS IN: transcription factor activity; INVOLVED IN: regulation of transcription; LOCATED IN: nucleus, cytoplasm; EXPRESSED IN: 23 plant structures; EXPRESSED DURING: 13 growth stages; CONTAINS InterPro DOMAIN/s: GRAS transcription factor (InterPro:IPR005202); BEST Arabidopsis thaliana protein match is: SCL1 (SCARECROW-LIKE 1); transcription factor (TAIR:AT1G21450.1); Has 1239 Blast hits to 1228 proteins in 191 species: Archae - 0; Bacteria - 4; Metazoa - 13; Fungi - 19; Plants - 1170; Viruses - 0; Other Eukaryotes - 33 (source: NCBI BLink).	640	1	QAAQQHQQQQQQQ	13	76.9230769230769	7	0.538461538461538	74	86	11	NQIPGIFFDQIGNRVAGGNGFSGKRTLADF	PFYSQAALNAFLSRSVKPRNYQNFQSPSPM	GO:0005634:nucleus;GO:0005737:cytoplasm;	GO:0006350:transcription;GO:0045449:regulation of transcription;	GO:0003700:sequence-specific DNA binding transcription factor activity;	---
>prot|EG:AT1G03490.1-P|cod|AT1G03490.1-TAIR|gene|AT1G03490-TAIR-G|ann|ANAC006 (Arabidopsis NAC domain containing protein 6); transcription factor; Arabidopsis NAC domain containing protein 6 (ANAC006); FUNCTIONS IN: transcription factor activity; INVOLVED IN: multicellular organismal development, regulation of transcription; EXPRESSED IN: cultured cell; CONTAINS InterPro DOMAIN/s: No apical meristem (NAM) protein (InterPro:IPR003441); BEST Arabidopsis thaliana protein match is: transcription factor (TAIR:AT1G19040.1); Has 1670 Blast hits to 1106 proteins in 103 species: Archae - 0; Bacteria - 24; Metazoa - 527; Fungi - 24; Plants - 556; Viruses - 101; Other Eukaryotes - 438 (source: NCBI BLink).	281	1	QQQQQQQQQQQRQ	13	92.3076923076923	11	0.846153846153846	229	241	81	DLTGFADSLETMLEGHEDREQPEEAELTVT	EDCDVTQEQEKDDVMVLINNPNDALALGNY	GO:0005634:nucleus;	GO:0006350:transcription;GO:0007275:multicellular organismal development;GO:0045449:regulation of transcription;	GO:0003677:DNA binding;GO:0003700:sequence-specific DNA binding transcription factor activity;	---
>prot|EG:AT2G35940.3-P|cod|AT2G35940.3-TAIR|gene|AT2G35940-TAIR-G|ann|BLH1 (BEL1-LIKE HOMEODOMAIN 1); DNA binding / protein heterodimerization/ protein homodimerization/ transcription factor; Encodes a member of the BEL-like homeodomain protein family. Ecotopic expression in the embryo sac leads to defects in nuclear migration and cellularization and embryo sacs with multiple egg cells. Loss of function alleles have no female gametophyte defects. The ecotopic expression phenotype requires KNAT3 because it can be suppressed by loss of KNAT3 function alleles. Localized to the nucleus but interaction with OFP1 relocates it to the cytoplasm.	680	1	QQQQQQQHHQQHQ	13	76.9230769230769	7	0.538461538461538	146	158	21	YGSHQVDPTHQQAACETPRAQQGLSLTLSS	PIHVGFGSGHGEDIRVGSGSTGSGVTNGIA	GO:0005575:cellular_component;GO:0005634:nucleus;GO:0005737:cytoplasm;	GO:0006350:transcription;GO:0006355:regulation of transcription, DNA-dependent;GO:0008150:biological_process;GO:0009610:response to symbiotic fungus;GO:0009737:response to abscisic acid stimulus;GO:0010197:polar nucleus fusion;GO:0045449:regulation of transcription;	GO:0003674:molecular_function;GO:0003677:DNA binding;GO:0003700:sequence-specific DNA binding transcription factor activity;GO:0005515:protein binding;GO:0030528:transcription regulator activity;GO:0042803:protein homodimerization activity;GO:0043565:sequence-specific DNA binding;GO:0046982:protein heterodimerization activity;	---
>prot|EG:AT3G22930.1-P|cod|AT3G22930.1-TAIR|gene|AT3G22930-TAIR-G|ann|calmodulin, putative; calmodulin, putative; FUNCTIONS IN: calcium ion binding; INVOLVED IN: biological_process unknown; EXPRESSED IN: 7 plant structures; EXPRESSED DURING: LP.06 six leaves visible, LP.04 four leaves visible, LP.10 ten leaves visible, LP.12 twelve leaves visible, LP.08 eight leaves visible; CONTAINS InterPro DOMAIN/s: EF-HAND 1 (InterPro:IPR018247), EF-HAND 2 (InterPro:IPR018249), EF-Hand type (InterPro:IPR011992), Calcium-binding EF-hand (InterPro:IPR002048), EF hand (InterPro:IPR018248); BEST Arabidopsis thaliana protein match is: CAM8 (CALMODULIN 8); calcium ion binding (TAIR:AT4G14640.1); Has 70712 Blast hits to 24982 proteins in 1601 species: Archae - 0; Bacteria - 1213; Metazoa - 27649; Fungi - 9879; Plants - 4664; Viruses - 162; Other Eukaryotes - 27145 (source: NCBI BLink).	173	1	QQQQQQQQQQQQQQQQQQQQQQELTQEQ	28	85.7142857142857	22	0.785714285714286	5	32	2	MEEIQQQQQQQQQQQQQQQQQQQQQQELTQ	IMEFKEAFCLFDKDGDGCITADELATVIRS	GO:0009288:bacterial-type flagellum;	GO:0001539:ciliary or flagellar motility;GO:0008150:biological_process;	GO:0005509:calcium ion binding;	---
>prot|EG:AT2G28540.1-P|cod|AT2G28540.1-TAIR|gene|AT2G28540-TAIR-G|ann|nucleic acid binding / nucleotide binding / protein binding / zinc ion binding; nucleic acid binding / nucleotide binding / protein binding / zinc ion binding; FUNCTIONS IN: protein binding, nucleotide binding, zinc ion binding, nucleic acid binding; EXPRESSED IN: 24 plant structures; EXPRESSED DURING: 15 growth stages; CONTAINS InterPro DOMAIN/s: RNA recognition motif, RNP-1 (InterPro:IPR000504), Zinc finger, RING-type (InterPro:IPR001841), Zinc finger, RING/FYVE/PHD-type (InterPro:IPR013083), Nucleotide-binding, alpha-beta plait (InterPro:IPR012677); BEST Arabidopsis thaliana protein match is: RNA recognition motif (RRM)-containing protein (TAIR:AT3G45630.1); Has 750 Blast hits to 532 proteins in 154 species: Archae - 0; Bacteria - 20; Metazoa - 236; Fungi - 103; Plants - 76; Viruses - 0; Other Eukaryotes - 315 (source: NCBI BLink).	882	1	QQQQQQ	6	100	6	1	868	873	98	AVGQGFENASLDFRSNFQGNTNMYGSAAKL	AVYRSISRQ	---	---	GO:0000166:nucleotide binding;GO:0003676:nucleic acid binding;GO:0005515:protein binding;GO:0008270:zinc ion binding;	---
>prot|EG:AT5G51590.1-P|cod|AT5G51590.1-TAIR|gene|AT5G51590-TAIR-G|ann|DNA-binding protein-related; DNA-binding protein-related; FUNCTIONS IN: DNA binding; INVOLVED IN: biological_process unknown; LOCATED IN: cellular_component unknown; EXPRESSED IN: 19 plant structures; EXPRESSED DURING: 9 growth stages; CONTAINS InterPro DOMAIN/s: Protein of unknown function DUF296 (InterPro:IPR005175), AT hook, DNA-binding, conserved site (InterPro:IPR017956); BEST Arabidopsis thaliana protein match is: DNA-binding protein-related (TAIR:AT4G25320.1); Has 887 Blast hits to 825 proteins in 101 species: Archae - 0; Bacteria - 8; Metazoa - 301; Fungi - 58; Plants - 449; Viruses - 14; Other Eukaryotes - 57 (source: NCBI BLink).	419	1	QQQQQQ	6	100	6	1	301	306	71	VFGGGLAGLFIAAGPVQVMVGSFIAGQEES	IKKQRRERLGIPTTTQASNISFGGSAEDPK	GO:0005575:cellular_component;	GO:0008150:biological_process;	GO:0003677:DNA binding;	---